BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0450 (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces ... 28 1.5 SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe... 26 6.0 SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyc... 26 6.0 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 25 8.0 >SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces pombe|chr 3|||Manual Length = 278 Score = 27.9 bits (59), Expect = 1.5 Identities = 13/56 (23%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 659 DRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSAR-LERNTVRPPILSTGTASA 495 D + LP+ + P + K+ ++F P+HH + + ++ +P +T A+A Sbjct: 148 DESVIDIPLPSEEYPFEDPKPREKKNKSFKPKHHKKQDINASSAQPKSTTTTEAAA 203 >SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe|chr 1|||Manual Length = 371 Score = 25.8 bits (54), Expect = 6.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 436 FRAIVAEKPLLSLFHYLLGWAEAVPVD 516 F++ +P LFHYL G+ P+D Sbjct: 312 FKSSQKHQPRNWLFHYLFGFGSTEPID 338 >SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 25.8 bits (54), Expect = 6.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -3 Query: 573 SATSPLCTLGTKHRAPADIIDRHRFRPTE*VMKQ*K*WFFSDDRAKRSPTYATPLMSPYN 394 S +PL LG P D++ +HR E + K FS + TY P MS Sbjct: 247 SGRAPLHLLGVSMNQPIDVVVQHRM--DEDYVAPFK--PFSGKGQRLGSTYMQPRMSQMP 302 Query: 393 ARL-ESSSTGSSFP 355 L +ST SS P Sbjct: 303 GGLYTDTSTSSSVP 316 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -2 Query: 241 GYLKRVIVTPAVYPRLLEFLHVDIQST 161 G+++R+ V YP LLE+L++ + S+ Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSS 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,859,510 Number of Sequences: 5004 Number of extensions: 57179 Number of successful extensions: 145 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -