BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0449 (676 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 0.43 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 4.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 9.2 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 25.4 bits (53), Expect = 0.43 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +2 Query: 41 GTPHQETARKVVHLVNYTHTDLPRNIRQGMSIVTKHLSYTAEALLKSVPVETAITEIKGW 220 G P QE V +N + PRN+ + T +A+L+ P +A ++ GW Sbjct: 11 GAPPQEMPTWFVRWLN---SQQPRNVPNFAAPSTSTAVQRPQAILQVRPSTSAAADVDGW 67 Query: 221 R 223 + Sbjct: 68 Q 68 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 4.0 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -2 Query: 672 VYLAIEGSGLQCH*GYREYIFTITLSFNVKKIFVLIKHMYLVRKKFEL 529 VYLAI +GL + +TLS + KK ++L + + + + +EL Sbjct: 309 VYLAIVFNGLFTEEDVADVPINVTLSLDEKK-YILQEVVRVKKPHYEL 355 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/35 (28%), Positives = 14/35 (40%) Frame = -1 Query: 367 WKTRRLFARKPTVAQSSPAPRYRPRIWLNAPSKFW 263 W T ++ P SP P P + PS F+ Sbjct: 188 WHTPSMYPLSPGAGFRSPYPSALPISTSSLPSDFY 222 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/35 (28%), Positives = 14/35 (40%) Frame = -1 Query: 367 WKTRRLFARKPTVAQSSPAPRYRPRIWLNAPSKFW 263 W T ++ P SP P P + PS F+ Sbjct: 80 WHTPSMYPLSPGAGFRSPYPSALPISTSSLPSDFY 114 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,452 Number of Sequences: 336 Number of extensions: 3599 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -