BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0449 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 27 0.72 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 25 2.9 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 24 5.0 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 5.0 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 6.7 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 6.7 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 6.7 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 6.7 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 6.7 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 8.8 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 8.8 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 26.6 bits (56), Expect = 0.72 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = +2 Query: 32 RADGTPHQETARKVVHLVNYTHTDLPRNIRQGMS--IVTKHLSYTAEALLKSVPVETAIT 205 +A G H+ A+ LV + PR + ++ H S T L++ P+ET I Sbjct: 217 KASGLFHKAIAQSGTALVPWGFQYRPRELAYRLADRFGYSHDSATLVQSLRNTPIETLIE 276 Query: 206 EIKGW 220 +GW Sbjct: 277 TQEGW 281 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 64 KKGRASRQLYTHRPSKKHPSRHVDCYEA 147 K G ++ H KH SR V CY A Sbjct: 152 KFGDEEHYIFQHDNDSKHTSRTVKCYLA 179 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 70 GRASRQLYTHRPSKKHPSRHVDCYEA 147 G ++ H KH SR V CY A Sbjct: 226 GDEEHYIFQHDNDSKHTSRTVKCYLA 251 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -2 Query: 411 AFTNANTLKLIDTVNGRHVVSLLVSRPWRNLLPLLV 304 AF N ++++ T+ GR S++ N+LP+L+ Sbjct: 53 AFILLNRIEIVRTLEGRFEESVIAYLFIVNILPILI 88 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.4 bits (48), Expect = 6.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 489 YSRWRTDETLNYNTAQI 539 Y+ + T+E LNYNT I Sbjct: 213 YNNFYTEEYLNYNTEDI 229 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.4 bits (48), Expect = 6.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 164 LLYTTNAS*QSTCLDGCF 111 + +T N S +CL GCF Sbjct: 411 IAFTANTSISCSCLPGCF 428 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.4 bits (48), Expect = 6.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 164 LLYTTNAS*QSTCLDGCF 111 + +T N S +CL GCF Sbjct: 411 IAFTANTSISCSCLPGCF 428 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 6.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 489 YSRWRTDETLNYNTAQI 539 Y+ + T+E LNYNT I Sbjct: 213 YNNFYTEEYLNYNTEDI 229 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 6.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 489 YSRWRTDETLNYNTAQI 539 Y+ + T+E LNYNT I Sbjct: 213 YNNFYTEEYLNYNTEDI 229 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/49 (22%), Positives = 21/49 (42%) Frame = +2 Query: 317 RRLRHGRLTSKETTCLPLTVSINFRVFAFVKA*SKTLELSRYIRHNDDY 463 R ++ G +E CL V+ N R + K + ++ + DD+ Sbjct: 66 RYVKEGYPDVEEVRCLLRCVAFNLRFWNHTTGLQKNMVAGHFVPYPDDF 114 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/49 (22%), Positives = 21/49 (42%) Frame = +2 Query: 317 RRLRHGRLTSKETTCLPLTVSINFRVFAFVKA*SKTLELSRYIRHNDDY 463 R ++ G +E CL V+ N R + K + ++ + DD+ Sbjct: 66 RYVKEGYPDVEEVRCLLRCVAFNLRFWNHTTGLQKNMVAGHFVPYPDDF 114 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 707,975 Number of Sequences: 2352 Number of extensions: 14318 Number of successful extensions: 33 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -