BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0448 (702 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 24 1.6 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 2.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 4.9 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 6.5 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 6.5 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 21 VEINMAVLSELIPVDKMKDRCSAAIENMKADFAKHLS 131 + I++ +LSE I +K D+C + N F+K LS Sbjct: 108 ISIDVKMLSECINANKSTDKCENGL-NFIICFSKLLS 143 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +3 Query: 96 ENMKADFAKHLSIRSTTGSIDTIP 167 +N++ D A+H+ S T S +T+P Sbjct: 417 KNIREDDARHIPHASVTDSENTVP 440 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/53 (20%), Positives = 23/53 (43%) Frame = +3 Query: 63 DKMKDRCSAAIENMKADFAKHLSIRSTTGSIDTIPVKFEGKEYELQELAQIVR 221 DK+KD E + D H + + G + +EG +++ + ++ R Sbjct: 670 DKLKDSRIKTTEKLSTDPNTHFQVNQSHGIKRSGSHSWEGDSFKVSKHEEVSR 722 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 636 LFYSLTTQSYFHKHLLPN 583 LF+S + +FH ++PN Sbjct: 120 LFFSNEKEGHFHNIIMPN 137 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 636 LFYSLTTQSYFHKHLLPN 583 LF+S + +FH ++PN Sbjct: 120 LFFSNEKEGHFHNIIMPN 137 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,300 Number of Sequences: 438 Number of extensions: 4001 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -