BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0445 (769 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1066 + 25785749-25785868,25785953-25786141,25786250-257864... 29 5.4 06_03_1274 + 28897491-28897707,28897804-28897935,28898029-288980... 28 7.1 11_06_0335 + 22441240-22441548,22441958-22442028,22442321-224423... 28 9.4 10_07_0057 + 12460986-12461036,12461108-12461161,12461420-124614... 28 9.4 06_01_0353 + 2545995-2546208,2546362-2546492,2546846-2546929,254... 28 9.4 04_04_1571 + 34504087-34504421,34505002-34505731,34506091-345120... 28 9.4 >12_02_1066 + 25785749-25785868,25785953-25786141,25786250-25786414, 25786649-25786999,25787924-25788001,25788137-25788277, 25788415-25788459,25788597-25788763,25788833-25788911, 25788985-25789067,25789219-25789348,25789432-25789564, 25789955-25790103,25790339-25790534,25791086-25791288 Length = 742 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 500 VNDLT*FPAMMSLKFNGKYFLTISCPLPTHSL 595 V+D+T + +++SL +GK+ TI LP L Sbjct: 359 VDDITMYISLVSLSIDGKFMCTIDVKLPEEEL 390 >06_03_1274 + 28897491-28897707,28897804-28897935,28898029-28898096, 28898216-28898280,28898468-28898534,28898630-28898917, 28898995-28899102,28899236-28899487,28899918-28899997, 28900092-28900185,28900728-28900810,28901319-28901873, 28902085-28902616 Length = 846 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -1 Query: 220 YENDVLFFIYNRQFNDALELGTIVNASGDRKAVGHDGEVAGLPD 89 Y V FF YN+ F+ + + T+V +G+ ++G G + L D Sbjct: 764 YSGSVGFFSYNKTFDLNIVIRTVVLHNGE-ASIGAGGAIVALSD 806 >11_06_0335 + 22441240-22441548,22441958-22442028,22442321-22442381, 22443252-22443326,22443431-22443478,22443565-22443666, 22443971-22444032,22444187-22444284,22444361-22444470 Length = 311 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 424 YTIAVEFSHSRDWLWNRASERG 489 Y +HSR+WLW SE G Sbjct: 26 YQKVTSLTHSRNWLWRLVSEPG 47 >10_07_0057 + 12460986-12461036,12461108-12461161,12461420-12461482, 12461666-12461716,12461996-12462057,12462156-12462318, 12462829-12462939,12463029-12463166,12463248-12463322, 12463420-12463540,12464827-12464981,12465080-12465154, 12465270-12465473,12465670-12465786 Length = 479 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +2 Query: 527 MMSLKFNGKYFLTISCPLPTHSL*QYSMVFRLLSMI 634 MM L GK I CP+P+HSL SMV R +++ Sbjct: 152 MMHLLIRGKKD-GILCPIPSHSLYTDSMVLRGATLV 186 >06_01_0353 + 2545995-2546208,2546362-2546492,2546846-2546929, 2546972-2547316,2547327-2547582,2547683-2547879 Length = 408 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = -2 Query: 765 FNQDLEEKLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRNTMEYC 598 + ++ + KL I + + + +L S G G IQN +N + R N YC Sbjct: 154 YYKEYQSKLAALIGQKNATAILSDALYIVSTGTGDFIQNYYHNASLSSRYNVNSYC 209 >04_04_1571 + 34504087-34504421,34505002-34505731,34506091-34512077, 34512493-34513964,34514114-34514377,34514761-34514978, 34515759-34516030,34516190-34516559,34516578-34516797, 34516819-34518931,34518941-34519193,34519269-34519401, 34520597-34521114,34521207-34522115,34522195-34522368, 34522833-34522882,34523963-34524035,34524413-34524477, 34524736-34525522,34525622-34525878,34525989-34526109, 34526315-34526956 Length = 5320 Score = 27.9 bits (59), Expect = 9.4 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = -2 Query: 759 QDLEEKLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRNTMEYCYKLWVG 580 Q LE N I+T D +RQ L S++ N++ + +D + +E C +WVG Sbjct: 1147 QLLELGKNNEIVT---DQVLRQELALVMPKIYSLLSNLIGSDEMDIVKVVLEGCRWIWVG 1203 Query: 579 NG 574 +G Sbjct: 1204 DG 1205 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,263,011 Number of Sequences: 37544 Number of extensions: 412071 Number of successful extensions: 1117 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1117 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -