BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0445 (769 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 25 3.4 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 24 4.5 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 24 4.5 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 4.5 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 24 4.5 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 23 7.9 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 24.6 bits (51), Expect = 3.4 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 648 VVNNLIIDKRRNTMEYCYKLWVG-NGQEIVRKYFPL 544 ++N I+ + RN+ME+C G G +VR+ P+ Sbjct: 85 LLNRKILQRLRNSMEHCMAGSGGLGGGAVVREALPI 120 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 24.2 bits (50), Expect = 4.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 204 RTSFSYLAGWKNHCS 248 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 24.2 bits (50), Expect = 4.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 204 RTSFSYLAGWKNHCS 248 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 499 RNYNLALKLGSTTNPSNERILRRWCRQA 416 R+ N LK+G T IL RW R+A Sbjct: 759 RSLNDILKVGPTIQQDTTDILLRWRRRA 786 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 24.2 bits (50), Expect = 4.5 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 623 LSMIRLLTTFWMMEPLPWLSYS 688 L+++ +LT +W M LP+L S Sbjct: 97 LTLVEILTKYWPMGRLPFLCKS 118 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 475 LGSTTNPSNERILRRW 428 LGST N ++ +L+RW Sbjct: 57 LGSTINGNSSELLKRW 72 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 781,624 Number of Sequences: 2352 Number of extensions: 16723 Number of successful extensions: 29 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -