BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0442 (485 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 2.3 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 3.0 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.0 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 5.3 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 5.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 7.0 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 9.2 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.6 bits (46), Expect = 2.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 243 LEAFGIIPRMVASHHRPLGRVHEPNVR 323 L +G I ++AS HR L NVR Sbjct: 215 LYVYGRISCVIASRHRNLEATESENVR 241 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 3.0 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 Query: 280 RTTGRSAECMNQMSETAVPLVLSS 351 + G+ +C N MSE V ++L + Sbjct: 170 KENGKEFDCHNYMSELTVDILLET 193 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 4.0 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 327 SFGHLVHALGRAAGGAKLPSAGLCRTPL 244 S LV A+ AGG PSAG P+ Sbjct: 393 SMSALVSAVRSPAGGQLPPSAGAPMPPI 420 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 5.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 382 GKTNLSHDGLNPAHVPF*WVNNPTLG 459 GK N +PA PF W ++ + G Sbjct: 404 GKENYQTMSRDPARTPFQWDDSVSAG 429 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 5.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 382 GKTNLSHDGLNPAHVPF*WVNNPTLG 459 GK N +PA PF W ++ + G Sbjct: 404 GKENYQTMSRDPARTPFQWDDSVSAG 429 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 7.0 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -2 Query: 256 PNASKAEASLAESGKDMLTVEPRESGGSKQC 164 PNAS + A S + P+ S G QC Sbjct: 741 PNASPSPAEQCASTTTITARSPQGSQGLLQC 771 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 3 TDYSEPRHRTELYPDLRSRDARVKKKTDSIDL 98 T SE + L+P L SRD ++ ++++L Sbjct: 407 TSASELVESSVLFPSLDSRDELHPRELEAVNL 438 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,359 Number of Sequences: 438 Number of extensions: 2658 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -