BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0440 (800 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 2.7 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 4.7 At5g42370.1 68418.m05159 expressed protein 29 4.7 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 4.7 At4g33560.1 68417.m04769 expressed protein 28 6.3 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 6.3 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 8.3 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 8.3 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 449 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 354 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -1 Query: 236 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 102 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 175 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 65 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 38 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 169 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At4g33560.1 68417.m04769 expressed protein Length = 95 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/41 (43%), Positives = 20/41 (48%) Frame = -3 Query: 333 YRLEALHLGDLLRIWVRTGATSPRTSPPEFSRSAESIRTPP 211 Y LH + R VRT R SPP S SA SIR+ P Sbjct: 31 YLFRLLHKEAMAR--VRTITVPSRPSPPTSSSSATSIRSKP 69 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 231 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 133 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 458 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 339 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 458 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 339 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,615,839 Number of Sequences: 28952 Number of extensions: 416011 Number of successful extensions: 1272 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1272 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -