BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0439 (665 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n... 84 3e-15 UniRef50_Q6CQE6 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 78 2e-13 UniRef50_A7SUM0 Cluster: Predicted protein; n=5; Nematostella ve... 69 8e-11 UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;... 68 2e-10 UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo... 62 1e-08 UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ... 60 5e-08 UniRef50_Q16984 Cluster: Alpha-L1 nicotinic acetyl choline recep... 50 4e-05 UniRef50_Q99JC0 Cluster: RRNA promoter binding protein; n=28; Eu... 47 5e-04 UniRef50_Q7TP33 Cluster: Aa1-330; n=1; Rattus norvegicus|Rep: Aa... 46 6e-04 UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0... 46 6e-04 UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1; ... 44 0.004 UniRef50_Q3U1V2 Cluster: B6-derived CD11 +ve dendritic cells cDN... 39 0.094 UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221... 38 0.16 UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa... 36 1.2 UniRef50_A6N073 Cluster: Putative uncharacterized protein; n=1; ... 35 2.0 UniRef50_Q8CM04 Cluster: Putative uncharacterized protein; n=8; ... 33 4.7 UniRef50_A6BKX8 Cluster: Putative uncharacterized protein; n=8; ... 33 6.2 UniRef50_Q7QW44 Cluster: GLP_457_25625_26368; n=2; Giardia intes... 33 6.2 >UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1; Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry - Xenopus tropicalis Length = 154 Score = 83.8 bits (198), Expect = 3e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 635 DDEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVN 516 +DEAFGYLKRVIVTPAVYPRL+EFLH DIQSTGQKSHCVN Sbjct: 113 NDEAFGYLKRVIVTPAVYPRLVEFLHFDIQSTGQKSHCVN 152 >UniRef50_Q6CQE6 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome D of strain NRRL Y- 1140 of Kluyveromyces lactis; n=2; Kluyveromyces lactis|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome D of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 144 Score = 77.8 bits (183), Expect = 2e-13 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -3 Query: 183 QTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTG 40 Q H P+LRANPY EVTD CRLPL TLFY+LEA+HLGDLLR+ VR G Sbjct: 58 QGPHCPILRANPYPEVTDLFCRLPLSTLFYQLEAVHLGDLLRLSVRPG 105 Score = 32.7 bits (71), Expect = 8.2 Identities = 19/35 (54%), Positives = 24/35 (68%), Gaps = 3/35 (8%) Frame = -3 Query: 483 LDSRIPLVRASSELTV---ERRSYRIVPIAHETKP 388 LDS+IPLVR SS+L V +RRS R +P T+P Sbjct: 1 LDSQIPLVRTSSKLIVNCSKRRSTRDLPRPSTTRP 35 >UniRef50_A7SUM0 Cluster: Predicted protein; n=5; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 123 Score = 69.3 bits (162), Expect = 8e-11 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 168 PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVR 46 P LRANP+ EVTD CRLPLPTLFY+ EA HLGDLLR+ VR Sbjct: 63 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRLLVR 103 >UniRef50_Q7RN96 Cluster: Putative senescence-associated protein; n=3; Eukaryota|Rep: Putative senescence-associated protein - Plasmodium yoelii yoelii Length = 205 Score = 67.7 bits (158), Expect = 2e-10 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = -1 Query: 632 DEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVNT 513 DE FGYLKRVIVTPAVY +EF VDI TGQKSHCVNT Sbjct: 144 DETFGYLKRVIVTPAVYLCFIEFHQVDIHGTGQKSHCVNT 183 Score = 55.2 bits (127), Expect = 1e-06 Identities = 30/73 (41%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = -2 Query: 664 VNPFMRVTN*MTRHLATLRES*LLPPFTRACLNFFTLTFRALG-RNHIASTPAGPSQCFV 488 VNPFM VTN L+ + P + F + G ++H +T +G SQC+V Sbjct: 134 VNPFMHVTN-YDETFGYLKRVIVTPAVYLCFIEFHQVDIHGTGQKSHCVNTISGFSQCYV 192 Query: 487 LIRQSDSPCPCQF 449 LI+QSDSPCP QF Sbjct: 193 LIKQSDSPCPFQF 205 >UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana tabacum (Common tobacco) Length = 530 Score = 62.1 bits (144), Expect = 1e-08 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -2 Query: 163 PQSQSLFRSYGSNLPTSLTYIILSTRGSSPWRPAADMGTN 44 PQSQS RSYGS LPTSL YI+ STRG SPWRP A +G N Sbjct: 224 PQSQSFSRSYGSILPTSLAYIVPSTRGCSPWRPDAFVGGN 263 Score = 48.4 bits (110), Expect = 2e-04 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 531 ITLRQHPRGHRNALF*LDSRIPLVRASSELTVER 430 ITLR R HRNALF L+SRIPLVR SSEL V R Sbjct: 145 ITLRNIRRDHRNALFKLNSRIPLVRTSSELAVRR 178 Score = 36.7 bits (81), Expect = 0.50 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -1 Query: 587 VYPRLLEFLHVDIQSTGQ 534 VYPRL+EFLH DIQSTG+ Sbjct: 127 VYPRLVEFLHFDIQSTGR 144 >UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC 50803 Length = 329 Score = 60.1 bits (139), Expect = 5e-08 Identities = 32/46 (69%), Positives = 33/46 (71%) Frame = -1 Query: 665 R*SIHARH*LDDEAFGYLKRVIVTPAVYPRLLEFLHVDIQSTGQKS 528 R SIHAR L DEAFGYLKRVIVTPAVY LH D + TGQKS Sbjct: 212 RWSIHARRKLPDEAFGYLKRVIVTPAVYQGFGGSLHSDGRGTGQKS 257 Score = 34.7 bits (76), Expect = 2.0 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -2 Query: 160 QSQSLFRSYGSNLPTSLTYIILSTRGSSPWRPAADMG 50 QS S R YG+ LPTSL+ + RG P PAA G Sbjct: 290 QSHSFSRGYGAGLPTSLSRVRSRARGCWPRSPAAWWG 326 >UniRef50_Q16984 Cluster: Alpha-L1 nicotinic acetyl choline receptor; n=1; Acheta domesticus|Rep: Alpha-L1 nicotinic acetyl choline receptor - Acheta domesticus (House cricket) Length = 39 Score = 50.4 bits (115), Expect = 4e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 141 EVTDPICRLPLPTLFYRLEALHLG 70 EVTDPICRLPLPT YRL+ALHLG Sbjct: 16 EVTDPICRLPLPTFVYRLDALHLG 39 >UniRef50_Q99JC0 Cluster: RRNA promoter binding protein; n=28; Euteleostomi|Rep: RRNA promoter binding protein - Rattus norvegicus (Rat) Length = 295 Score = 46.8 bits (106), Expect = 5e-04 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -1 Query: 197 IRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYS 96 +R P++P P EPILIPKLRI+ ADFPYLH S Sbjct: 146 LRAPARPTQPL--EPILIPKLRIRLADFPYLHCS 177 Score = 37.5 bits (83), Expect = 0.29 Identities = 26/61 (42%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Frame = -3 Query: 204 RPHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFY-----RLEALHLGDLLRIWVRTG 40 RP PL AP P + P R+ L Y EA+HLGDLLRIWVR G Sbjct: 142 RPAPL-----RAPARPTQPLEPILIPKLRIRLADFPYLHCSNMPEAVHLGDLLRIWVRPG 196 Query: 39 A 37 A Sbjct: 197 A 197 >UniRef50_Q7TP33 Cluster: Aa1-330; n=1; Rattus norvegicus|Rep: Aa1-330 - Rattus norvegicus (Rat) Length = 151 Score = 46.4 bits (105), Expect = 6e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 86 RLFTLETCCGYGYEPARHLHVHP 18 RLFTLETCCGYGY PAR LH P Sbjct: 25 RLFTLETCCGYGYGPARDLHPLP 47 >UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG00134 - Rattus norvegicus (Rat) Length = 221 Score = 46.4 bits (105), Expect = 6e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 86 RLFTLETCCGYGYEPARHLHVHP 18 RLFTLETCCGYGY PAR LH P Sbjct: 95 RLFTLETCCGYGYGPARDLHPLP 117 >UniRef50_Q7YT64 Cluster: Tyrosine-protein kinase receptor; n=1; Crassostrea gigas|Rep: Tyrosine-protein kinase receptor - Crassostrea gigas (Pacific oyster) (Crassostrea angulata) Length = 804 Score = 43.6 bits (98), Expect = 0.004 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +2 Query: 521 RNVISAQCSECQREEIQASAGKRRE 595 RNVISAQCSECQ EEIQ+S GK E Sbjct: 1 RNVISAQCSECQSEEIQSSEGKGGE 25 >UniRef50_Q3U1V2 Cluster: B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F730204M12 product:hypothetical protein, full insert sequence; n=3; Amniota|Rep: B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F730204M12 product:hypothetical protein, full insert sequence - Mus musculus (Mouse) Length = 136 Score = 39.1 bits (87), Expect = 0.094 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 1 LENSGEGCTWRCRAGSYPYPQQVSKVKSL 87 L+ G GC + RAG YPYPQQVSKV SL Sbjct: 104 LKIRGRGC--KSRAGPYPYPQQVSKVNSL 130 >UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221; n=2; Pyrococcus|Rep: Putative uncharacterized protein PH0221 - Pyrococcus horikoshii Length = 235 Score = 38.3 bits (85), Expect = 0.16 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -1 Query: 665 R*SIHARH*LDDEAFGYLKRVIVTPAVY 582 R +IHA L D+ F YLKRVIVTPAVY Sbjct: 30 RYAIHAGRHLTDKEFRYLKRVIVTPAVY 57 >UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa group|Rep: Zgc:165536 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 55 Score = 35.5 bits (78), Expect = 1.2 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 623 MPRHLISDAHEWIN 664 MPRHLISDAHEW+N Sbjct: 1 MPRHLISDAHEWMN 14 >UniRef50_A6N073 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 39 Score = 34.7 bits (76), Expect = 2.0 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +1 Query: 94 IE*CR*GKSANWIRNFGIRIGSE 162 +E CR GKSA IRNFG RIGSE Sbjct: 1 MEQCRQGKSAKRIRNFGKRIGSE 23 >UniRef50_Q8CM04 Cluster: Putative uncharacterized protein; n=8; Bacteria|Rep: Putative uncharacterized protein - Corynebacterium efficiens Length = 261 Score = 33.5 bits (73), Expect = 4.7 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = -1 Query: 170 PRSSEPILIPKLRIQFADFPYLHYSID*RL--FTLETCCGYGYEPARHL 30 P + L+PKLR FA+F L++S RL L TC G GY P H+ Sbjct: 95 PSPVQAPLLPKLRGHFAEF--LNHSSPERLSILYLTTCVGLGYGPNMHI 141 >UniRef50_A6BKX8 Cluster: Putative uncharacterized protein; n=8; Clostridiales|Rep: Putative uncharacterized protein - Dorea longicatena DSM 13814 Length = 109 Score = 33.1 bits (72), Expect = 6.2 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -2 Query: 151 SLFRSYGSNLPTSLTYIILSTRGSSPWRPAADMGT 47 S RSYG LP+SLT ++ S G SP P + GT Sbjct: 13 SFSRSYGVILPSSLTMLLPSALGFSPHPPVSVYGT 47 >UniRef50_Q7QW44 Cluster: GLP_457_25625_26368; n=2; Giardia intestinalis|Rep: GLP_457_25625_26368 - Giardia lamblia ATCC 50803 Length = 247 Score = 33.1 bits (72), Expect = 6.2 Identities = 19/48 (39%), Positives = 24/48 (50%) Frame = -2 Query: 445 ADR*TAVVQNRADRARNETDTTLRLGRSAEGRRTRVRIQSET*DDFRE 302 ADR N NET + GR A+GRR R++SE D FR+ Sbjct: 55 ADRLVDTANNTFIHEINETSACMICGRIADGRRVIDRVRSEAVDFFRK 102 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,902,064 Number of Sequences: 1657284 Number of extensions: 14675449 Number of successful extensions: 39707 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 38069 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39692 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 50826451017 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -