BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0439 (665 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 3.0 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 5.2 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 207 HRPHPLPVQTRHAPVLRANPYS 142 +R HPL + + H +L NP S Sbjct: 332 NRCHPLSLSSDHQAMLHHNPMS 353 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.8 bits (44), Expect = 5.2 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 233 YVRFSELDFNIMRPQ-KLYIFNMTLAKIVLRFGLDPDPRSP 352 Y+ F E N + + L + + LA +V F DP R+P Sbjct: 427 YLPFGEGPRNCIGQRFALLVSKVALASVVKDFVFDPTERTP 467 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,430 Number of Sequences: 336 Number of extensions: 3476 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -