BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0439 (665 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0098 + 25560158-25560925 32 0.47 03_04_0090 + 17228253-17228403,17229062-17229129,17229238-172309... 31 0.82 02_05_0110 + 25914110-25915006,25915726-25915797,25916411-259166... 30 1.9 02_03_0076 - 14861337-14861974,14862008-14862119,14862150-14863580 30 1.9 12_01_0796 + 7292523-7292783,7292963-7293018,7295274-7295331,729... 29 2.5 06_01_0268 + 1989069-1989293,1989938-1990020,1990136-1990357,199... 29 4.4 04_03_0732 + 19095320-19095827,19095848-19096621,19096863-190969... 29 4.4 03_05_0379 + 23628200-23628366,23629074-23629133,23630177-236302... 28 5.8 12_02_0854 + 23697826-23698033,23699111-23699276,23699430-236994... 28 7.7 11_08_0081 - 28216179-28216381,28216590-28216657,28217131-282172... 28 7.7 05_04_0162 + 18645459-18645827,18645934-18646149,18646224-186462... 28 7.7 >05_06_0098 + 25560158-25560925 Length = 255 Score = 31.9 bits (69), Expect = 0.47 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = -3 Query: 207 HRPHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTGATSP 28 HRP P P + P L +P + V I P PT F + + ++++ + T P Sbjct: 31 HRPPPPPPSSSSQPALPPSPRTVVPRTIDTTPFPTTFVQADTASFKQVVQMLTGSDTTPP 90 >03_04_0090 + 17228253-17228403,17229062-17229129,17229238-17230902, 17231002-17231143,17231648-17232399 Length = 925 Score = 31.1 bits (67), Expect = 0.82 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 6/33 (18%) Frame = -3 Query: 228 TNIDQTRH------RPHPLPVQTRHAPVLRANP 148 T IDQ H + H +PVQ H+PVL+ NP Sbjct: 324 TQIDQPSHCQRIKNQDHSVPVQKNHSPVLKTNP 356 >02_05_0110 + 25914110-25915006,25915726-25915797,25916411-25916699, 25916864-25916949,25917267-25917490,25917674-25917740, 25917830-25917889,25917995-25918078,25918475-25918555 Length = 619 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -1 Query: 638 LDDEAFGYL-KRVIVTPAVYPRLLEFLHVDIQSTG 537 LDDE YL R V + RLL+F++VD STG Sbjct: 279 LDDEDISYLTNRAAVYIEMGKRLLKFIYVDPSSTG 313 >02_03_0076 - 14861337-14861974,14862008-14862119,14862150-14863580 Length = 726 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 568 NFFTLTFRALGRNHIASTPAGPSQCFVLIRQSDSPCPC 455 NF R L + HIAS +GP +C + C C Sbjct: 225 NFLPSCVRCLDKGHIASNCSGPVRCHSCLEAGHMSCFC 262 >12_01_0796 + 7292523-7292783,7292963-7293018,7295274-7295331, 7295777-7295843,7296461-7296516,7296638-7296691, 7296836-7296961 Length = 225 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 198 HPLPVQTRHAPVLRANPYSEVTDPICRLPL 109 H L + RH P L+A P S + C+LPL Sbjct: 107 HSLIIPKRHFPSLQATPPSVIAAICCKLPL 136 >06_01_0268 + 1989069-1989293,1989938-1990020,1990136-1990357, 1990434-1990621,1990711-1990835,1990988-1991039, 1991585-1991874,1992229-1992307,1992527-1992657 Length = 464 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -3 Query: 192 LPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEAL 79 +P Q + A + A+P + V C LP P+LF L L Sbjct: 292 IPYQFQEATSILASPLAHVPASSCPLPAPSLFSSLPLL 329 >04_03_0732 + 19095320-19095827,19095848-19096621,19096863-19096906, 19097191-19097250 Length = 461 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 Query: 204 RPHPLPVQTRHAPVLRANPYSEVTDP 127 RP+PL V +RHA VL + V DP Sbjct: 133 RPNPLDVVSRHAGVLSRGDHCLVVDP 158 >03_05_0379 + 23628200-23628366,23629074-23629133,23630177-23630209, 23630253-23630665,23631522-23632008,23632623-23633334 Length = 623 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 520 STPAGPSQCFVLIRQSDSPCPC 455 S P G S CF + SPCPC Sbjct: 314 SCPCGASFCFGCAAPAHSPCPC 335 >12_02_0854 + 23697826-23698033,23699111-23699276,23699430-23699466, 23699531-23700145 Length = 341 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -1 Query: 230 ARTSTRPGTGRIRFPSKPDTPRSSE 156 A TST PG GR R PS P TP S+ Sbjct: 16 AATSTDPGRGRKRPPS-PSTPTPSD 39 >11_08_0081 - 28216179-28216381,28216590-28216657,28217131-28217298, 28217370-28217436,28217509-28217576,28218256-28218420, 28218490-28218556,28218629-28218696,28219855-28219992, 28220189-28220353,28221227-28221304,28221380-28221532, 28222753-28222823,28223077-28223203,28223306-28223565, 28223679-28223842,28224287-28224450,28225873-28226159 Length = 826 Score = 27.9 bits (59), Expect = 7.7 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = -3 Query: 246 LKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP--ICRLPLPTLFYRLEALHL 73 +K + N+D RP P PV LRA PY P + + L + L ++++ Sbjct: 1 MKPSPAANLDVRVERPRPPPVHPHRPGSLRARPYYRRWTPWIVAAIALSCVVVFLVSMYV 60 Query: 72 GDLLR 58 D R Sbjct: 61 NDCPR 65 >05_04_0162 + 18645459-18645827,18645934-18646149,18646224-18646278, 18646545-18646672,18647134-18647217,18648742-18648867, 18648949-18649086 Length = 371 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -1 Query: 218 TRPGTGRIRFPSKPDTPRSSEPILIPKLR 132 TRP TG+ P K D RS + I KLR Sbjct: 108 TRPRTGKAALPLKRDRTRSKRFLEIQKLR 136 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,458,199 Number of Sequences: 37544 Number of extensions: 430309 Number of successful extensions: 1253 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1253 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -