BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0438 (636 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18860.2 68416.m02396 transducin family protein / WD-40 repea... 28 4.5 At3g18860.1 68416.m02395 transducin family protein / WD-40 repea... 28 4.5 >At3g18860.2 68416.m02396 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to phospholipase a-2-activating protein SP:P27612 from [Mus musculus] Length = 760 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 577 VKKCNGVPPGLERERETLNESVMERDILRRGAEVNVLSDLAHY 449 +KK L + ++S+ E ++ R GA VN+L D +HY Sbjct: 505 LKKMTEFNTTLRSDAVNNDKSLTELEVSRVGAIVNILKDTSHY 547 >At3g18860.1 68416.m02395 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to phospholipase a-2-activating protein SP:P27612 from [Mus musculus] Length = 760 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 577 VKKCNGVPPGLERERETLNESVMERDILRRGAEVNVLSDLAHY 449 +KK L + ++S+ E ++ R GA VN+L D +HY Sbjct: 505 LKKMTEFNTTLRSDAVNNDKSLTELEVSRVGAIVNILKDTSHY 547 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,165,049 Number of Sequences: 28952 Number of extensions: 223801 Number of successful extensions: 497 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 497 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -