BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0437 (766 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes ... 52 2e-05 UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 50 6e-05 UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: ... 48 3e-04 UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;... 42 0.013 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 39 0.12 UniRef50_A7HQK3 Cluster: Cytochrome c oxidase subunit II; n=1; P... 36 0.83 UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|... 36 1.1 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 34 3.4 UniRef50_Q8BL71 Cluster: Adult male corpora quadrigemina cDNA, R... 33 5.9 UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; ... 33 7.8 >UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes scapularis|Rep: Putative secreted protein - Ixodes scapularis (Black-legged tick) (Deer tick) Length = 65 Score = 52.0 bits (119), Expect = 2e-05 Identities = 25/51 (49%), Positives = 31/51 (60%) Frame = +3 Query: 63 EGDIAKGSIYQCWCLRSYSVTWITVVILELIHAIRTLTSDGMSACIRSKPI 215 +G+ A GS+ Q W LRS+ TWITV ILELIHA+ A IR + I Sbjct: 4 QGETANGSLNQLWFLRSFLPTWITVAILELIHAVSPKPLGATGAFIRPRSI 54 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 50.0 bits (114), Expect = 6e-05 Identities = 29/54 (53%), Positives = 32/54 (59%) Frame = -3 Query: 668 GAPTARRTNATTSFLTATILVYXXXXXXXXXXXTRLALQLFLVKIFKVYSFRLQ 507 G P AR + TTSFLTA L+Y TRLALQ LVK FKV SF+LQ Sbjct: 30 GGPPARSQDPTTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFKVDSFQLQ 83 >UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: LRRG00114 - Rattus norvegicus (Rat) Length = 223 Score = 48.0 bits (109), Expect = 3e-04 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 436 LLPSLDVVAVSQAPSPESNPDSP 368 LLPSLDVVAVSQAPSPE NPDSP Sbjct: 167 LLPSLDVVAVSQAPSPELNPDSP 189 >UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein; n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein - Gallus gallus Length = 508 Score = 42.3 bits (95), Expect = 0.013 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 122 YLDNCGNSRANTCNQNSDQ*WDECLY*IKTN 214 YLDNCGNSRANTC + D C+Y KTN Sbjct: 468 YLDNCGNSRANTCRRAPTS-GDACIYQTKTN 497 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -1 Query: 415 VAVSQAPSPESNPDSPLPVTTMVVAETTIES 323 +A+SQAPSPESN +SPLPV M+ I+S Sbjct: 372 LAISQAPSPESNSNSPLPVKAMLGQYPNIKS 402 >UniRef50_A7HQK3 Cluster: Cytochrome c oxidase subunit II; n=1; Parvibaculum lavamentivorans DS-1|Rep: Cytochrome c oxidase subunit II - Parvibaculum lavamentivorans DS-1 Length = 394 Score = 36.3 bits (80), Expect = 0.83 Identities = 25/67 (37%), Positives = 32/67 (47%) Frame = -3 Query: 557 LQLFLVKIFKVYSFRLQAS*ESRIVIFRHYLPCREWVICAPAAFLGCGSRFSGSLSGIEP 378 L L L ++F+V F S +I + R R ICA AA GC SG LS ++P Sbjct: 140 LDLRLDRVFRVVGFAHDTSPIRKITLLRRGPFRRAAAICAGAALSGC----SGDLSALDP 195 Query: 377 *FPVTRD 357 P RD Sbjct: 196 AGPAARD 202 >UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|Rep: Novel protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 118 Score = 35.9 bits (79), Expect = 1.1 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 308 MSALSTFDGSFCDYHG 355 MSALSTFDG+FC YHG Sbjct: 1 MSALSTFDGTFCAYHG 16 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 34.3 bits (75), Expect = 3.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 594 SWNYRGCWHQTCP 556 SWNYR CWHQT P Sbjct: 7 SWNYRSCWHQTGP 19 >UniRef50_Q8BL71 Cluster: Adult male corpora quadrigemina cDNA, RIKEN full-length enriched library, clone:B230353G19 product:weakly similar to GROUP III SECRETED PHOSPHOLIPASE A2; n=1; Mus musculus|Rep: Adult male corpora quadrigemina cDNA, RIKEN full-length enriched library, clone:B230353G19 product:weakly similar to GROUP III SECRETED PHOSPHOLIPASE A2 - Mus musculus (Mouse) Length = 218 Score = 33.5 bits (73), Expect = 5.9 Identities = 20/78 (25%), Positives = 28/78 (35%) Frame = +1 Query: 199 LDQNQSTEGLASEVVNFDDLDNFCRSHGQVPATHLSNVCLINFRW*FLRLPWLSRVTGNQ 378 L N ++ D D CR++G P HL N W + S Q Sbjct: 58 LQYNYGIRNFRFHTISHCDCDARCRAYGSTPLAHLRPRTYYNASW---KAEATSYTPSPQ 114 Query: 379 GSIPEREPEKRLPHPRKA 432 P + P+KR P +A Sbjct: 115 SPAPSKHPQKRGPQQTQA 132 >UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; Roseovarius sp. HTCC2601|Rep: Putative uncharacterized protein - Roseovarius sp. HTCC2601 Length = 507 Score = 33.1 bits (72), Expect = 7.8 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +3 Query: 114 YSVTWITVVILELIHAIRTLTSDGMSACIRSKPIDGGPRV 233 YS T + VV+ EL+ T+ SD +A I + P+DG R+ Sbjct: 139 YSATSMAVVLSELVVDDETIPSDNAAAQISAGPVDGETRI 178 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 760,283,361 Number of Sequences: 1657284 Number of extensions: 15518478 Number of successful extensions: 38741 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 36992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38726 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 63792713725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -