BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbVm0433
(780 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ... 33 1.5
>AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor
marker CA125 protein.
Length = 22152
Score = 32.7 bits (71), Expect = 1.5
Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
Frame = -2
Query: 500 KSPVSLFFVTT---SRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVA 342
++P + ++TT SG F+ + PS+ + + SPES P SPLPVT ++ +
Sbjct: 5614 RTPGDVSWMTTPPVEETSSG-FSLMSPSMTSPSPVSSTSPESIPSSPLPVTALLTS 5668
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,722,811
Number of Sequences: 237096
Number of extensions: 2369303
Number of successful extensions: 5737
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5572
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5737
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9478778060
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -