BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0430 (836 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039047-11|AAB94230.1| 354|Caenorhabditis elegans Prion-like-(... 30 1.8 U29535-9|AAK31453.2| 2148|Caenorhabditis elegans Hypothetical pr... 29 3.1 U23529-9|AAL32210.1| 713|Caenorhabditis elegans G-protein-linke... 29 5.4 U23529-8|AAL32209.1| 682|Caenorhabditis elegans G-protein-linke... 29 5.4 AF117300-1|AAF26201.1| 713|Caenorhabditis elegans G protein-lin... 29 5.4 AF075245-1|AAD13747.1| 682|Caenorhabditis elegans G protein-lin... 29 5.4 AC006655-1|AAF39875.1| 391|Caenorhabditis elegans Serpentine re... 29 5.4 Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical pr... 28 7.2 M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-re... 28 7.2 >AF039047-11|AAB94230.1| 354|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 51 protein. Length = 354 Score = 30.3 bits (65), Expect = 1.8 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 2/71 (2%) Frame = -1 Query: 437 IDQTRHRPHPLPVQTRHAP--VLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRIWV 264 +D + P P P Q H P +R NP P+ + P+ L L A H+GD Sbjct: 53 VDLESNAPPPAPRQQHHVPPSAVRPNPMPP-QRPVAQQPVRAL-SALHAAHIGDAPIRMA 110 Query: 263 RTGRHLHVHPS 231 TG+ HPS Sbjct: 111 YTGQPTQ-HPS 120 >U29535-9|AAK31453.2| 2148|Caenorhabditis elegans Hypothetical protein C25H3.8 protein. Length = 2148 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = -1 Query: 452 T*RTNIDQTRHRPHPLPVQ---TRHAPVLRANPYSEVTDPI 339 T +++ID T H PHP+ VQ T+ V+ P V+ P+ Sbjct: 904 TLKSSIDITNHLPHPIAVQTEGTKGGEVMSVEPNGVVSVPL 944 >U23529-9|AAL32210.1| 713|Caenorhabditis elegans G-protein-linked acetylcholinereceptor protein 1, isoform b protein. Length = 713 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 469 LTR*NEHNARTSTRPGTGRIRFPSKPDT 386 LT NE+ TS++PG R+ P+K DT Sbjct: 557 LTVNNENRGETSSQPGRDRLAPPNKTDT 584 >U23529-8|AAL32209.1| 682|Caenorhabditis elegans G-protein-linked acetylcholinereceptor protein 1, isoform a protein. Length = 682 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 469 LTR*NEHNARTSTRPGTGRIRFPSKPDT 386 LT NE+ TS++PG R+ P+K DT Sbjct: 526 LTVNNENRGETSSQPGRDRLAPPNKTDT 553 >AF117300-1|AAF26201.1| 713|Caenorhabditis elegans G protein-linked acetylcholinereceptor GAR-1a protein. Length = 713 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 469 LTR*NEHNARTSTRPGTGRIRFPSKPDT 386 LT NE+ TS++PG R+ P+K DT Sbjct: 557 LTVNNENRGETSSQPGRDRLAPPNKTDT 584 >AF075245-1|AAD13747.1| 682|Caenorhabditis elegans G protein-linked acetylcholinereceptor GAR-1b protein. Length = 682 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 469 LTR*NEHNARTSTRPGTGRIRFPSKPDT 386 LT NE+ TS++PG R+ P+K DT Sbjct: 526 LTVNNENRGETSSQPGRDRLAPPNKTDT 553 >AC006655-1|AAF39875.1| 391|Caenorhabditis elegans Serpentine receptor, class w protein6 protein. Length = 391 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 595 LTARKIRGRPENAGPDPVRNVRRFSRVSYKYIQFLRPHYIKILTR*NEH 449 +T RKIR N DP ++ R+ Y + FL +++ L EH Sbjct: 1 MTTRKIRPTTTNPKDDPDYDLERYYYGDYTHRNFLTDFFLRYLEFSGEH 49 >Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical protein F29D11.1 protein. Length = 4753 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 667 WHGQGESDCLIKTKHCDGPRGC*RNVISAQCS 762 W+ G C+ + K CDG + C QCS Sbjct: 267 WNCPGTGHCIDQLKLCDGSKDCADGADEQQCS 298 >M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-related protein protein. Length = 4753 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 667 WHGQGESDCLIKTKHCDGPRGC*RNVISAQCS 762 W+ G C+ + K CDG + C QCS Sbjct: 267 WNCPGTGHCIDQLKLCDGSKDCADGADEQQCS 298 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,815,709 Number of Sequences: 27780 Number of extensions: 441353 Number of successful extensions: 1314 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1314 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2066533546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -