BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0430 (836 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 26 0.50 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 26 0.50 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 26 0.50 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 26 0.50 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 26 0.50 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 26 0.50 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 24 1.5 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 3.5 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 3.5 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 3.5 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 3.5 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 4.6 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 4.6 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 6.1 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 8.1 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.50 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 639 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 541 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.50 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 639 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 541 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.50 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 639 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 541 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.50 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 639 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 541 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 25.8 bits (54), Expect = 0.50 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 639 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 541 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 25.8 bits (54), Expect = 0.50 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 639 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 541 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 1.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 639 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 541 RT SC SR + RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDLRHEDRNSYRNDGERSCSRDRS 258 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 639 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 541 RT SC SR + +RH+ +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDGNSYRNDGERSCSRDRS 258 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 3.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 628 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 527 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 3.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 628 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 527 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 3.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 628 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 527 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 4.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 405 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 503 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 4.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 405 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 503 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.2 bits (45), Expect = 6.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 98 PDLSAASSGHFGLPRRTLVFK 36 PDL+ S G GLP L + Sbjct: 336 PDLAGTSQGSAGLPSAILAMR 356 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 8.1 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -1 Query: 167 SEPYLPSIGFHGTRTLRQKRKLFPDLSA 84 SE P+ HG R RQ+ + D + Sbjct: 472 SENNYPTTSIHGDRLQRQREEALADFKS 499 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 247,224 Number of Sequences: 438 Number of extensions: 6005 Number of successful extensions: 22 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26824317 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -