BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0429 (784 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08480.1 68417.m01399 mitogen-activated protein kinase, putat... 30 1.5 At3g07040.1 68416.m00836 disease resistance protein RPM1 (CC-NBS... 29 3.5 At5g24850.1 68418.m02938 cryptochrome dash (CRYD) nearly identic... 28 8.0 At2g35890.1 68415.m04406 calcium-dependent protein kinase, putat... 28 8.0 At2g27810.2 68415.m03372 xanthine/uracil permease family protein... 28 8.0 At2g27810.1 68415.m03371 xanthine/uracil permease family protein... 28 8.0 >At4g08480.1 68417.m01399 mitogen-activated protein kinase, putative similar to mitogen-activated protein kinase [Arabidopsis thaliana] gi|1255448|dbj|BAA09057; contains Pfam PF00069: Protein kinase domain Length = 773 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = -3 Query: 386 KFYIDASYPEGNFGRNQLLDGSISLSPLYPVPTIDLHVRIATVLIRVSPDFDLTRHSSPS 207 K +D+ E G + + P+ +P +DL +L +PD ++ R S S Sbjct: 375 KEVVDSGTVENRRGIKGVRPSVLKPPPVMKLPPVDLPGSSWDILTHFAPDSEIVRRPSSS 434 Query: 206 FGSQHLCSE 180 S++ C E Sbjct: 435 SSSENGCDE 443 >At3g07040.1 68416.m00836 disease resistance protein RPM1 (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Identical to RPM1 (gi:1361985) Length = 926 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +2 Query: 353 FPQDSWRRYKILKQSHPVKRMIRGIGAETTSTYSQTLNG*ELRLTRTMKPEIDDG-AKWA 529 FP+ W R+ I ++ V MI+ I +++ Y + N + P IDDG AKW Sbjct: 104 FPRYMWARHSIAQKLGMVNVMIQSI-SDSMKRYYHSEN-----YQAALLPPIDDGDAKWV 157 Query: 530 N 532 N Sbjct: 158 N 158 >At5g24850.1 68418.m02938 cryptochrome dash (CRYD) nearly identical to cryptochrome dash [Arabidopsis thaliana] GI:28971609; similar to Deoxyribodipyrimidine photolyase (DNA photolyase) (Photoreactivating enzyme)(SP:Q55081){Synechocystis sp.} Length = 526 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 304 YTQFRRSICTSESLRSSSGFPLT 236 YTQFR+S+ S+RSS+ PL+ Sbjct: 195 YTQFRKSVEAKCSIRSSTRIPLS 217 >At2g35890.1 68415.m04406 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK). [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 520 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 628 MTAGRWPWKSESAKECATTHLPKQPALKMDGAEAFC 735 +T+ WP SESAK+ L + P ++ + C Sbjct: 351 LTSDPWPQVSESAKDLIRKMLERNPIQRLTAQQVLC 386 >At2g27810.2 68415.m03372 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 660 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 584 PKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 685 P KR D+ VGRS DG +GS +P+R R+ Sbjct: 114 PVKRRRDSDGVVGRSNGPDGANGSGDPVRRPGRI 147 >At2g27810.1 68415.m03371 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 709 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 584 PKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 685 P KR D+ VGRS DG +GS +P+R R+ Sbjct: 114 PVKRRRDSDGVVGRSNGPDGANGSGDPVRRPGRI 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,531,916 Number of Sequences: 28952 Number of extensions: 389642 Number of successful extensions: 882 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -