BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0427 (792 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 28 1.8 SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyc... 25 9.4 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 9.4 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.9 bits (59), Expect = 1.8 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -3 Query: 736 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMFSTHRDCESTAY 602 Y+C + +S G L SED ++ W K GLI+ F + E+ Y Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173 >SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 25.4 bits (53), Expect = 9.4 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = -2 Query: 575 ARGARKVTTGITGLWQPSVHSDVLFDPSMSALPIIAKQNSPSVGLFTHQKGT*AGFRPS* 396 A GAR T IT Q S S V +P+ S + N+P+ + + T + F Sbjct: 145 ASGARTQRTSITNDPQSSQSSSVSRNPASSRAGSPTRDNAPAASPASSEPRTFSSFEDQY 204 Query: 395 DRL 387 RL Sbjct: 205 GRL 207 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.4 bits (53), Expect = 9.4 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 619 SPYAY*TSGSSQLLPFCSTRGF 684 SPYA+ T S+ L PF STR + Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,271,035 Number of Sequences: 5004 Number of extensions: 66509 Number of successful extensions: 158 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -