BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0423 (751 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 22 4.6 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 22 4.6 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 6.0 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 346 ISLVFDFILGDFSVVIDNCFCSSVILDLSVV 254 ISL+F ++GD V+++ +V L +V Sbjct: 246 ISLIFVVLIGDAYAVLNSVLFQNVYKPLPIV 276 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 346 ISLVFDFILGDFSVVIDNCFCSSVILDLSVV 254 ISL+F ++GD V+++ +V L +V Sbjct: 246 ISLIFVVLIGDAYAVLNSVLFQNVYKPLPIV 276 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = +1 Query: 367 ISIRNFQRSTLIFKCSHNKISNTSLITF-----WSLKFSK 471 +S NF+ + + CS+ + + S TF W + FSK Sbjct: 101 VSNNNFKTYSNVTTCSYYSLDDLSEDTFYDIRLWGVSFSK 140 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,021 Number of Sequences: 336 Number of extensions: 2673 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -