BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0422 (430 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1002.11 |gaa1||GPI-anchor transamidase complex subunit Gaa1 ... 29 0.40 SPCC1739.04c |||sequence orphan|Schizosaccharomyces pombe|chr 3|... 27 0.93 SPAC23H4.10c |thi4||thiamine-phosphate dipyrophosphorylase/hydro... 27 0.93 SPBC577.03c |||GCN5-related N-acetyltransferase |Schizosaccharom... 25 3.8 >SPAC1002.11 |gaa1||GPI-anchor transamidase complex subunit Gaa1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 28.7 bits (61), Expect = 0.40 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 150 STLIFKCSHNKISNTSLITFW 88 ST IF CS +KI N L+ FW Sbjct: 512 STFIFLCSLSKILNGPLVPFW 532 >SPCC1739.04c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 288 Score = 27.5 bits (58), Expect = 0.93 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 141 IFKCSHNKISNTSLITFWSLKFSKIMAKH 55 I K SH+KIS + LIT + +S++ K+ Sbjct: 18 ISKISHSKISISELITLLDIHYSELFTKN 46 >SPAC23H4.10c |thi4||thiamine-phosphate dipyrophosphorylase/hydroxyethylthiazole kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 518 Score = 27.5 bits (58), Expect = 0.93 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 337 RHLAEHLNSSCTCSLGHVRIRGINGSNL 420 R + EH+ S C LG V I G+N SN+ Sbjct: 153 RKILEHV-SKMHCQLGTVAIAGLNSSNI 179 >SPBC577.03c |||GCN5-related N-acetyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 216 Score = 25.4 bits (53), Expect = 3.8 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 283 NGEVKNHRAAK-QLSITTEKSPSIKSKTKLIRSQIKLNFY 167 +G KN + K ++ + ++ PSI+ KL SQ+K N Y Sbjct: 165 SGIAKNKQILKYRVKVGSQNKPSIRLFKKLGFSQVKYNAY 204 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,497,622 Number of Sequences: 5004 Number of extensions: 26015 Number of successful extensions: 53 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 154448264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -