BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0420 (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.64 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.64 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 5.9 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 7.8 SPBC8D2.05c |sfi1||spindle pole body protein Sfi1|Schizosaccharo... 25 7.8 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.64 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 402 SGCGRCRVWSMFVRYVRFSE 461 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.64 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 585 ARKIRGRPENAGPDPVRNVRRFSRV 511 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 5.9 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 181 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 44 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 7.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 439 TNIDQTRHRPHPLPVQTRHAPV 374 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPBC8D2.05c |sfi1||spindle pole body protein Sfi1|Schizosaccharomyces pombe|chr 2|||Manual Length = 840 Score = 25.4 bits (53), Expect = 7.8 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 487 QKLYIFNRHSRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARF 630 QK +F +HS + W ++ +A L +KVV +SF A + Sbjct: 302 QKANVFFQHSVLAHSFKTWKANLSIKNAATLYEKKVVFMSFNRWHANY 349 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,987,032 Number of Sequences: 5004 Number of extensions: 63626 Number of successful extensions: 196 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 196 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -