BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0418 (779 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 30 0.32 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.75 SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces po... 27 3.0 SPAC10F6.11c |||kinase activator |Schizosaccharomyces pombe|chr ... 26 7.0 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 26 7.0 SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr... 25 9.2 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 9.2 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 9.2 SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycos... 25 9.2 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 30.3 bits (65), Expect = 0.32 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 169 SGCGRCRVWSMFVRYVRFSELVF*YNAASKLYIF 270 +GCG+ VW +VR+V F E + LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.75 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 352 ARKIRGRPENAGPDPVRNVRRFSRV 278 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces pombe|chr 2|||Manual Length = 622 Score = 27.1 bits (57), Expect = 3.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 777 MLHLSVSLQCQTRVKLNRSSFPADSPKPVPLAVVSL 670 M+ L L+C+T +N + P KP+PL+ V L Sbjct: 265 MIILENCLECKTAKVVNITQKPKTKYKPLPLSTVEL 300 >SPAC10F6.11c |||kinase activator |Schizosaccharomyces pombe|chr 1|||Manual Length = 481 Score = 25.8 bits (54), Expect = 7.0 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +1 Query: 607 RHLISDAHEWINEIPTVLSTI*RNHSQGNGLGRISGERRPVELDSSLAL 753 R L DAH++ + T L + H Q L +++ + LDSS AL Sbjct: 89 RQLCGDAHKFNEDAKTDLRNSIKQHQQLKELAKLTAS-QCTRLDSSTAL 136 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.8 bits (54), Expect = 7.0 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = -2 Query: 598 GYLKRVIVTPAVYPRLLEFLHVDIQSTGQKHIASTPARAIAMLCFN*TVGFPLSVP 431 G+++R+ V YP LLE+L++ + S+ K++ S + A L F T P+S P Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSS-YKYLLSN-SGANFTLQFT-TPSGPVSTP 128 >SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 25.4 bits (53), Expect = 9.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 723 SSFPADSPKPVPLAVVSLDSR*DSGNLVNPF 631 S P +P+PVP V++D + D + PF Sbjct: 547 SYIPEPNPQPVPETEVTIDPKSDRLEALEPF 577 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 9.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 206 TNIDQTRHRPHPLPVQTRHAPV 141 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 9.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 94 FPYLHYSID*RLFTLETCCGYGYEPARHL 8 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 25.4 bits (53), Expect = 9.2 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = +2 Query: 254 QNCIYLI*HSRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNW 433 Q +YL S Y +D RTR++ PSA + + ++ R T V S + Sbjct: 133 QYLVYLTTLYLDSPYTTDLQRTRLILPSAKIDTYTTYNIDGAELPNRVGNTLVYESRETI 192 Query: 434 HGQ 442 G+ Sbjct: 193 TGE 195 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,195,884 Number of Sequences: 5004 Number of extensions: 65523 Number of successful extensions: 161 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 377352472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -