BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0416 (749 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 72 4e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 57 2e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 52 4e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 51 9e-07 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 48 6e-06 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 4.0 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 625 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 625 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 625 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +1 Query: 625 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 TAGR + ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 56.8 bits (131), Expect = 2e-08 Identities = 33/61 (54%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = -3 Query: 621 ERPTPFMVSHERFLG-ALNTFGSSHSASSAYQNWPTWHRIRSPASSFE*AGVLTHLKFEN 445 E+PTPF+ S ER L FGSS ASS YQN PT RI P + + G+LT+LKFEN Sbjct: 58 EQPTPFVGSDERRLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLKFEN 116 Query: 444 R 442 R Sbjct: 117 R 117 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 646 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 646 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 52.4 bits (120), Expect = 4e-07 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = +2 Query: 554 DEPNV-FKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 679 DEPN + +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 646 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 652 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 744 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 655 SAKECATTHLPKQPALKMDGAEAFCLYTTV 744 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 655 SAKECATTHLPKQPALKMDGAEAFCLYTTV 744 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 655 SAKECATTHLPKQPALKMDGAEAFCLYTTV 744 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 655 SAKECATTHLPKQPALKMDGAEAFCLYTTV 744 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 48.4 bits (110), Expect = 6e-06 Identities = 26/45 (57%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -3 Query: 642 WPPSCCH--ERPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 W P + E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 71 WLPQASYPCEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 115 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 48.0 bits (109), Expect = 8e-06 Identities = 24/37 (64%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = -3 Query: 624 HERPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 122 YEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 158 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/44 (61%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPTWHRIRSPAS 490 +PTPF+ S ER L LN FGSS ASSAYQN P RI PAS Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +1 Query: 658 AKECATTHLPKQPALKMDGAEAFCLYTTV 744 AKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 39 AKECVTTHLPKQLALKMDGAQASHLYRAV 67 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/38 (57%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +2 Query: 554 DEPNV-FKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 664 DEPN + +RS D KGVG S QQDGGHGS NP + Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNPAK 40 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 621 ERPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 41 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 76 Score = 34.7 bits (76), Expect = 0.081 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 733 IGKTLQRHPFSGLVASA 683 IG TL+RHPFSGLVASA Sbjct: 24 IGATLERHPFSGLVASA 40 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 621 ERPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 38 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 73 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 621 ERPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 74 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 621 ERPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 E+PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 74 Score = 34.7 bits (76), Expect = 0.081 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 733 IGKTLQRHPFSGLVASA 683 IG TL+RHPFSGLVASA Sbjct: 22 IGATLERHPFSGLVASA 38 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/38 (60%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +2 Query: 554 DEPNV-FKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 664 DEPN + +RS D KGVG S QQDGGHGS NPL+ Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLK 40 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +1 Query: 661 KECATTHLPKQPALKMDGAEAFCLYTTV 744 KEC TT LPKQ ALKMDGA+A LY V Sbjct: 40 KECVTTPLPKQLALKMDGAQASHLYRAV 67 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 4e-05 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT--WHRIRSPASS 487 +PTPF+ S ER L LN FGSS ASSAYQ WPT H + P S Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLGDPLES 48 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNHAFGSSRIASSAYQKWPT 36 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/36 (63%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = -3 Query: 621 ERPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 E+PTPF+ S ER L LN FGSS ASSA Q WPT Sbjct: 58 EQPTPFVGSDERRLWHLNRAFGSSRIASSALQKWPT 93 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/35 (62%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN +GSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAYGSSRIASSAYQKWPT 36 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +3 Query: 585 NAHGTP*KALVAHDSRTVAMEVGIR 659 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/35 (62%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = -3 Query: 618 RPTPFMVSHERFLGALN-TFGSSHSASSAYQNWPT 517 +PTPF+ S ER L LN FGSS ASSAYQ PT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKGPT 36 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +1 Query: 646 KSESAKECATTHLPKQPALKM 708 K ESAKEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -1 Query: 254 PPSGFPLTST*PGIVHHLSGPSICA 180 PP FPL S GIVHHLSGP+ CA Sbjct: 5 PPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 36.7 bits (81), Expect = 0.020 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -3 Query: 255 ASIRVSPDFDLTRHSSPSFGSQHLCS 178 AS RVS F L RHSSPSFGSQ + S Sbjct: 39 ASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 315 ISLSPLYPVPTIDLHVRIATAS 250 ISLSPLYP TIDLHVR + S Sbjct: 38 ISLSPLYPNLTIDLHVRSNSCS 59 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 677 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 582 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,205,235 Number of Sequences: 59808 Number of extensions: 526152 Number of successful extensions: 1366 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 1190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1338 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -