BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0416 (749 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z30423-9|CAA83012.1| 385|Caenorhabditis elegans Hypothetical pr... 29 4.7 AY071926-1|AAL61544.1| 385|Caenorhabditis elegans RNA interfere... 29 4.7 AL034365-6|CAA22263.1| 347|Caenorhabditis elegans Hypothetical ... 28 6.2 AC006624-7|AAF39787.1| 642|Caenorhabditis elegans Hypothetical ... 28 8.1 >Z30423-9|CAA83012.1| 385|Caenorhabditis elegans Hypothetical protein T20G5.11 protein. Length = 385 Score = 28.7 bits (61), Expect = 4.7 Identities = 20/80 (25%), Positives = 31/80 (38%), Gaps = 1/80 (1%) Frame = -3 Query: 669 TLLSGFRLPWPPSCCHERPTPF-MVSHERFLGALNTFGSSHSASSAYQNWPTWHRIRSPA 493 ++ G +P PS + TP E FL +A + YQ PTW + P Sbjct: 10 SVFGGSDVPMKPSRSEDNKTPRNRTDLEMFLKKTPLMVLEEAAKAVYQKTPTWGTVELP- 68 Query: 492 SSFE*AGVLTHLKFENRLRS 433 FE +L + + + S Sbjct: 69 EGFEMTLILNEITVKGQATS 88 >AY071926-1|AAL61544.1| 385|Caenorhabditis elegans RNA interference promoting factor protein. Length = 385 Score = 28.7 bits (61), Expect = 4.7 Identities = 20/80 (25%), Positives = 31/80 (38%), Gaps = 1/80 (1%) Frame = -3 Query: 669 TLLSGFRLPWPPSCCHERPTPF-MVSHERFLGALNTFGSSHSASSAYQNWPTWHRIRSPA 493 ++ G +P PS + TP E FL +A + YQ PTW + P Sbjct: 10 SVFGGSDVPMKPSRSEDNKTPRNRTDLEMFLKKTPLMVLEEAAKAVYQKTPTWGTVELP- 68 Query: 492 SSFE*AGVLTHLKFENRLRS 433 FE +L + + + S Sbjct: 69 EGFEMTLILNEITVKGQATS 88 >AL034365-6|CAA22263.1| 347|Caenorhabditis elegans Hypothetical protein Y69E1A.6 protein. Length = 347 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 566 RLVHPTAPVLLTKIGPLGTASDLRLHRSSKPE 471 R HP +TK+GP LRL + S PE Sbjct: 315 RAQHPIISTQMTKVGPPSADISLRLKKLSAPE 346 >AC006624-7|AAF39787.1| 642|Caenorhabditis elegans Hypothetical protein C53D5.5 protein. Length = 642 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 8/78 (10%) Frame = +2 Query: 164 MKARSEHKCWDPKDGELCLVRSKSGETLMEAVA-----ILTCKSIVGTGYRGERL---IE 319 M ++S ++ K EL V G T++ VA L K+ V R+ ++ Sbjct: 521 MSSQSPLVIFNTKGAELMAVGGAGGSTIISGVAGVALHALWLKADVKQAVDAPRMHNQLQ 580 Query: 320 PSSSWFRPKFPSG*LASI 373 P+ +W+ P FP + S+ Sbjct: 581 PNYTWYEPNFPKAYVKSL 598 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,657,285 Number of Sequences: 27780 Number of extensions: 385894 Number of successful extensions: 739 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -