BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0415 (727 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q59001 Cluster: Probable glycogen synthase; n=6; Methan... 36 1.3 UniRef50_Q6BK16 Cluster: Similar to CA0248|IPF7262 Candida albic... 33 5.4 UniRef50_A2EK57 Cluster: Putative uncharacterized protein; n=1; ... 33 9.5 >UniRef50_Q59001 Cluster: Probable glycogen synthase; n=6; Methanococcales|Rep: Probable glycogen synthase - Methanococcus jannaschii Length = 521 Score = 35.5 bits (78), Expect = 1.3 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = -1 Query: 376 HSVRLIHL*KPSENLKAELCNCVNVNSEYMLKLISYSLPLNNIFF 242 H +R + L K +++ L N N + +L LI YSLPL+++ F Sbjct: 326 HDIRFVFLTKGDRDIEERLKNLANEHDGRILALIGYSLPLSSLVF 370 >UniRef50_Q6BK16 Cluster: Similar to CA0248|IPF7262 Candida albicans IPF7262; n=1; Debaryomyces hansenii|Rep: Similar to CA0248|IPF7262 Candida albicans IPF7262 - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 309 Score = 33.5 bits (73), Expect = 5.4 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 331 LNFQKAFINVLI*QSARYENGSNLISHVLIYNTIGYYN 444 LN++ +NV+ Q+ + NG L+ V +YNTIG N Sbjct: 254 LNYKLQLLNVVKEQNKAFRNGQVLVKEVKMYNTIGARN 291 >UniRef50_A2EK57 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 1818 Score = 32.7 bits (71), Expect = 9.5 Identities = 19/60 (31%), Positives = 34/60 (56%) Frame = +3 Query: 177 FARCTYSIYMYITYKCSVVHQIKKMLLRGNEYEISFNMYSELTFTQLHSSAFKFSEGFYK 356 FAR T S+ ++Y V++++K +LL +YE S +M S + L++ F GF++ Sbjct: 967 FARQTMSLKDVLSY---VIYRLKLLLLA--KYECSISMSSSNLYPSLYNGKFSMETGFFQ 1021 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 511,231,545 Number of Sequences: 1657284 Number of extensions: 8371057 Number of successful extensions: 15060 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15058 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 59090914597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -