BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0414 (647 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 24 0.94 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 430 IQFFFIKETVYISSNLSYKSSIKRLMICYLCTVKIL 537 + FFI +N Y S+ + C L VKIL Sbjct: 22 LNIFFITPWYDFPTNQKYYPSLAKCYACLLMVVKIL 57 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 IKKLNSIFFYKRDSLYFIQSFIQV 488 IKKL I S YFI F+ V Sbjct: 281 IKKLGKIKENLEQSRYFIYMFVSV 304 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 IKKLNSIFFYKRDSLYFIQSFIQV 488 IKKL I S YFI F+ V Sbjct: 281 IKKLGKIKENLEQSRYFIYMFVSV 304 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 IKKLNSIFFYKRDSLYFIQSFIQV 488 IKKL I S YFI F+ V Sbjct: 281 IKKLGKIKENLEQSRYFIYMFVSV 304 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 IKKLNSIFFYKRDSLYFIQSFIQV 488 IKKL I S YFI F+ V Sbjct: 281 IKKLGKIKENLEQSRYFIYMFVSV 304 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,418 Number of Sequences: 336 Number of extensions: 2276 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -