BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0413 (683 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0547 - 17032318-17032392,17032893-17032962,17032979-170331... 29 2.6 11_04_0163 + 14296868-14297380,14297548-14297622,14298149-14298223 29 3.4 >04_03_0547 - 17032318-17032392,17032893-17032962,17032979-17033103, 17033196-17033252,17034152-17034217 Length = 130 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 307 KTIKRNPSDGGHIKRKTK-LLFLFNSEHFHIYLH 405 K +R PS GG I K LL L++ +H H ++H Sbjct: 89 KDPERKPSLGGDISLPAKILLMLYDQDHTHSFMH 122 >11_04_0163 + 14296868-14297380,14297548-14297622,14298149-14298223 Length = 220 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 298 NKLKTIKRNPSDGGHIKRKTK-LLFLFNSEHFHIYLH 405 N + +R PS GG I T+ LL L++ +H Y+H Sbjct: 176 NNMMDSERKPSLGGEIAPPTEILLMLYDQDHTPTYMH 212 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,214,115 Number of Sequences: 37544 Number of extensions: 304296 Number of successful extensions: 497 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 497 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -