BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0413 (683 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC005094-1|AAH05094.1| 394|Homo sapiens transmembrane protein 7... 30 8.8 AL589685-4|CAI14162.1| 394|Homo sapiens novel protein protein. 30 8.8 >BC005094-1|AAH05094.1| 394|Homo sapiens transmembrane protein 79 protein. Length = 394 Score = 29.9 bits (64), Expect = 8.8 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 284 ILLYKINLKQSKGIRPTGDTSKEKQNYCFYLIPSIFIFI-YILNLLWTST 430 IL+Y ++L +RP G+ +E + + Y+ S+ +FI Y NL ST Sbjct: 254 ILVYGLSLLCFSALRPFGEPRREVEIHRRYVAQSVQLFILYFFNLAVLST 303 >AL589685-4|CAI14162.1| 394|Homo sapiens novel protein protein. Length = 394 Score = 29.9 bits (64), Expect = 8.8 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 284 ILLYKINLKQSKGIRPTGDTSKEKQNYCFYLIPSIFIFI-YILNLLWTST 430 IL+Y ++L +RP G+ +E + + Y+ S+ +FI Y NL ST Sbjct: 254 ILVYGLSLLCFSALRPFGEPRREVEIHRRYVAQSVQLFILYFFNLAVLST 303 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,354,420 Number of Sequences: 237096 Number of extensions: 1812888 Number of successful extensions: 2398 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2398 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -