BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0413 (683 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069195-1|AAL39340.1| 257|Drosophila melanogaster GH25425p pro... 29 4.5 AE014134-2237|AAF53219.2| 257|Drosophila melanogaster CG6180-PA... 29 4.5 L14849-1|AAA28748.1| 548|Drosophila melanogaster tyrosine phosp... 29 7.8 L11253-1|AAA75339.1| 548|Drosophila melanogaster protein ( D.me... 29 7.8 L11252-1|AAA75338.1| 535|Drosophila melanogaster protein ( D.me... 29 7.8 L11251-1|AAA75349.1| 535|Drosophila melanogaster protein ( D.me... 29 7.8 L11250-1|AAA75348.1| 548|Drosophila melanogaster protein ( D.me... 29 7.8 AE014296-243|AAF47487.1| 548|Drosophila melanogaster CG9181-PA,... 29 7.8 AE014296-242|AAF47486.1| 535|Drosophila melanogaster CG9181-PB,... 29 7.8 >AY069195-1|AAL39340.1| 257|Drosophila melanogaster GH25425p protein. Length = 257 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 682 DYVPILYKQLGA 647 DYVPILYKQLGA Sbjct: 246 DYVPILYKQLGA 257 >AE014134-2237|AAF53219.2| 257|Drosophila melanogaster CG6180-PA protein. Length = 257 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 682 DYVPILYKQLGA 647 DYVPILYKQLGA Sbjct: 246 DYVPILYKQLGA 257 >L14849-1|AAA28748.1| 548|Drosophila melanogaster tyrosine phosphatase protein. Length = 548 Score = 28.7 bits (61), Expect = 7.8 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 138 KYFLDACKSVSYRTKQKQFSVIYNFRYRNRD*N----VGFHDHFYIVL 7 +++ + C++ K+KQFS + R+ NR N V +DH IVL Sbjct: 32 RFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVL 79 >L11253-1|AAA75339.1| 548|Drosophila melanogaster protein ( D.melanogaster proteintyrosine phosphatase mRNA, complete cds. ). Length = 548 Score = 28.7 bits (61), Expect = 7.8 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 138 KYFLDACKSVSYRTKQKQFSVIYNFRYRNRD*N----VGFHDHFYIVL 7 +++ + C++ K+KQFS + R+ NR N V +DH IVL Sbjct: 32 RFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVL 79 >L11252-1|AAA75338.1| 535|Drosophila melanogaster protein ( D.melanogaster proteintyrosine phosphatase mRNA, complete cds. ). Length = 535 Score = 28.7 bits (61), Expect = 7.8 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 138 KYFLDACKSVSYRTKQKQFSVIYNFRYRNRD*N----VGFHDHFYIVL 7 +++ + C++ K+KQFS + R+ NR N V +DH IVL Sbjct: 32 RFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVL 79 >L11251-1|AAA75349.1| 535|Drosophila melanogaster protein ( D.melanogaster proteintyrosine phosphatase gene, complete cds. ). Length = 535 Score = 28.7 bits (61), Expect = 7.8 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 138 KYFLDACKSVSYRTKQKQFSVIYNFRYRNRD*N----VGFHDHFYIVL 7 +++ + C++ K+KQFS + R+ NR N V +DH IVL Sbjct: 32 RFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVL 79 >L11250-1|AAA75348.1| 548|Drosophila melanogaster protein ( D.melanogaster proteintyrosine phosphatase gene, exons 2-6 and complete cds.). Length = 548 Score = 28.7 bits (61), Expect = 7.8 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 138 KYFLDACKSVSYRTKQKQFSVIYNFRYRNRD*N----VGFHDHFYIVL 7 +++ + C++ K+KQFS + R+ NR N V +DH IVL Sbjct: 32 RFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVL 79 >AE014296-243|AAF47487.1| 548|Drosophila melanogaster CG9181-PA, isoform A protein. Length = 548 Score = 28.7 bits (61), Expect = 7.8 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 138 KYFLDACKSVSYRTKQKQFSVIYNFRYRNRD*N----VGFHDHFYIVL 7 +++ + C++ K+KQFS + R+ NR N V +DH IVL Sbjct: 32 RFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVL 79 >AE014296-242|AAF47486.1| 535|Drosophila melanogaster CG9181-PB, isoform B protein. Length = 535 Score = 28.7 bits (61), Expect = 7.8 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 138 KYFLDACKSVSYRTKQKQFSVIYNFRYRNRD*N----VGFHDHFYIVL 7 +++ + C++ K+KQFS + R+ NR N V +DH IVL Sbjct: 32 RFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVL 79 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,661,984 Number of Sequences: 53049 Number of extensions: 573906 Number of successful extensions: 936 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2992560750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -