BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0409 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 32 0.069 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.64 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 7.9 SPBP8B7.28c |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 7.9 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 25 7.9 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 32.3 bits (70), Expect = 0.069 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 190 SGCGRCRVWSMFVRYVRFSELVFNIMRPQKLYIF 291 +GCG+ VW +VR+V F E LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.64 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 373 ARKIRGRPENAGPDPVRNVRRFSRV 299 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 7.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 227 TNIDQTRHRPHPLPVQTRHAPV 162 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPBP8B7.28c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 215 Score = 25.4 bits (53), Expect = 7.9 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 437 RSAQNWHGQGESDCLIKTKHCDGPAGVDA 523 R N G+ ++DCLI C G+D+ Sbjct: 25 RGTLNSKGKNDNDCLIMCMRCRKVKGIDS 53 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.4 bits (53), Expect = 7.9 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -2 Query: 619 GYLKRVIVTPAVYPRLLEFLHVDIQST 539 G+++R+ V YP LLE+L++ + S+ Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSS 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,901,783 Number of Sequences: 5004 Number of extensions: 59100 Number of successful extensions: 149 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -