BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0404 (751 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;... 97 3e-19 UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ... 91 3e-17 UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n... 73 8e-12 UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative... 69 1e-10 UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ... 65 2e-09 UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;... 64 5e-09 UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; ... 63 6e-09 UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0... 60 8e-08 UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47... 53 9e-06 UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella ve... 51 3e-05 UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontog... 47 6e-04 UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2; ... 42 0.012 UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; ... 38 0.20 UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; ... 36 0.81 UniRef50_O74086 Cluster: Putative uncharacterized protein PHS003... 36 1.1 UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia scl... 35 2.5 UniRef50_Q0U498 Cluster: Putative uncharacterized protein; n=1; ... 34 3.3 UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; ... 34 4.3 UniRef50_A4DID9 Cluster: Putative uncharacterized protein; n=10;... 33 5.7 UniRef50_UPI0000E2442A Cluster: PREDICTED: hypothetical protein;... 33 9.9 UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20; ... 33 9.9 >UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein; n=4; Eukaryota|Rep: Putative senescence-associated protein - Pisum sativum (Garden pea) Length = 282 Score = 97.5 bits (232), Expect = 3e-19 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +3 Query: 366 HQ*GKTNLSHDGLNPAHVPF*WVNNPTLGEFCFAMIGRADIEGSKSNV 509 HQ GKTNLSHDGL PAHVP+ WVNNPTLGEFCF MIGRADIEGSKSNV Sbjct: 57 HQWGKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKSNV 104 Score = 83.4 bits (197), Expect = 5e-15 Identities = 44/66 (66%), Positives = 46/66 (69%) Frame = +2 Query: 497 KKQRAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIKPAFALLLHAR 676 K AMNAWLPQASYPCGNFS TS K LKDR A LS+ + VL I IK AF LL H R Sbjct: 101 KSNVAMNAWLPQASYPCGNFSDTSSFKFRSLKDRLATLSRFVFVLEIRIKRAFTLLFHTR 160 Query: 677 FLSSLS 694 FL SLS Sbjct: 161 FLFSLS 166 Score = 33.1 bits (72), Expect = 7.5 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 697 ALGHLRYSLTDVTPQSNS 750 +LGHLRY LTDV PQ NS Sbjct: 168 SLGHLRYLLTDVPPQPNS 185 >UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 116 Score = 91.1 bits (216), Expect = 3e-17 Identities = 50/81 (61%), Positives = 57/81 (70%) Frame = -2 Query: 750 GV*LGRYICQRITQVS*GQLSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIKSF* 571 GV LGR CQ ITQ S QLSE+ NL +KR KA LI +FS + + ES AYRSF+ SF Sbjct: 5 GVCLGRNACQTITQASQVQLSENGNLTQNKRVKATLILIFSRNTNRESVAYRSFNFTSFK 64 Query: 570 QEVPEKLPQG*LACGSQAFIA 508 EV EKLPQG LACGSQ FI+ Sbjct: 65 LEVSEKLPQGQLACGSQEFIS 85 Score = 57.6 bits (133), Expect = 3e-07 Identities = 30/57 (52%), Positives = 34/57 (59%) Frame = -1 Query: 586 YKEFLARGARKVTTGITGLWQPSVHSTLLFDPSMSALPIIAKQNSPSVGLFTHQKGT 416 + F + K+ G STLLFDPSMSALPII KQNS VGLFT Q+GT Sbjct: 60 FTSFKLEVSEKLPQGQLACGSQEFISTLLFDPSMSALPIIVKQNSQRVGLFTRQQGT 116 >UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1; Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry - Xenopus tropicalis Length = 154 Score = 72.9 bits (171), Expect = 8e-12 Identities = 36/56 (64%), Positives = 40/56 (71%) Frame = +1 Query: 583 YTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVTPQSNS 750 Y GSIG AF V +RTE+ +Q SF PF E+SVL EL LGHLRY LTDV PQ NS Sbjct: 25 YPCGSIGHAFTVCIRTENQNQMSFYPFVLHEISVLVELILGHLRYLLTDVPPQPNS 80 Score = 38.7 bits (86), Expect = 0.15 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 497 KKQRAMNAWLPQASYPCGN 553 K AMNAWLPQASYPCG+ Sbjct: 11 KSNVAMNAWLPQASYPCGS 29 >UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative; n=1; Plasmodium vivax|Rep: Senescence-associated protein, putative - Plasmodium vivax Length = 131 Score = 68.9 bits (161), Expect = 1e-10 Identities = 33/54 (61%), Positives = 39/54 (72%) Frame = +1 Query: 589 KGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVTPQSNS 750 KGSIG AF +E +Q SF PF+ +E+SVL+EL GHLRY LTDV PQSNS Sbjct: 49 KGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLSELVFGHLRYYLTDVPPQSNS 102 Score = 40.7 bits (91), Expect = 0.037 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +2 Query: 497 KKQRAMNAWLPQASYPCGNFSGTS 568 K A +AW PQASYPCGNFS TS Sbjct: 11 KSYVARSAWQPQASYPCGNFSDTS 34 >UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; Dikarya|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 160 Score = 65.3 bits (152), Expect = 2e-09 Identities = 32/55 (58%), Positives = 37/55 (67%) Frame = +1 Query: 586 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVTPQSNS 750 +KGSIG F V + TE+ +Q F PF E+SVL E LGHLRY LTDV PQ NS Sbjct: 26 SKGSIGHTFMVCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNS 80 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +2 Query: 512 MNAWLPQASYPCGNFSGTS 568 MNAWLPQASYPCGNFSGTS Sbjct: 1 MNAWLPQASYPCGNFSGTS 19 >UniRef50_Q7RN96 Cluster: Putative senescence-associated protein; n=3; Eukaryota|Rep: Putative senescence-associated protein - Plasmodium yoelii yoelii Length = 205 Score = 63.7 bits (148), Expect = 5e-09 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = +1 Query: 583 YTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVTPQSNS 750 Y GSIG AF +E +Q SF PF+ +E+SVL EL GHL Y LTDV PQSNS Sbjct: 25 YPCGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLFELVFGHLCYFLTDVPPQSNS 80 Score = 34.7 bits (76), Expect = 2.5 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +2 Query: 491 RIKKQRAMNAWLPQASYPCGN 553 R K A NAW PQASYPCG+ Sbjct: 9 RSKSYVAKNAWQPQASYPCGS 29 >UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 108 Score = 63.3 bits (147), Expect = 6e-09 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = +1 Query: 589 KGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVTPQSNS 750 KGSIG AF V +RT + +Q SF F E+ VL +L LGHLRY LTDV+PQ NS Sbjct: 25 KGSIGYAFNVRIRTGNQNQTSFYHFVLHEIFVLVKLILGHLRYLLTDVSPQPNS 78 >UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG00134 - Rattus norvegicus (Rat) Length = 221 Score = 59.7 bits (138), Expect = 8e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCF MIGRADIEGSKS+V Sbjct: 25 WVNNPTLGEFCFTMIGRADIEGSKSDV 51 Score = 49.2 bits (112), Expect = 1e-04 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 497 KKQRAMNAWLPQASYPCGNFSGTSC*K 577 K AMNAW PQASYPCGNFS TSC K Sbjct: 48 KSDVAMNAWPPQASYPCGNFSDTSCLK 74 >UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47; Eukaryota|Rep: Uncharacterized protein YLR162W-A - Saccharomyces cerevisiae (Baker's yeast) Length = 62 Score = 52.8 bits (121), Expect = 9e-06 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +1 Query: 616 VPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVTPQSNS 750 V + TE+ +Q F PF E+SVL E LGHLRY LTDV PQ NS Sbjct: 2 VCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNS 46 >UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 746 Score = 51.2 bits (117), Expect = 3e-05 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 352 IVILLSTRGTAVSDIWFMHSAERPVVRSYH 263 +VILLSTRGTA SD W +H AE+P+VRSYH Sbjct: 660 VVILLSTRGTADSDNWHLHLAEKPMVRSYH 689 >UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontoglires|Rep: 4933429F08Rik protein - Mus musculus (Mouse) Length = 29 Score = 46.8 bits (106), Expect = 6e-04 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = +2 Query: 512 MNAWLPQASYPCGNFSGTSC*K 577 MNAW PQASYPCGNFS TSC K Sbjct: 1 MNAWPPQASYPCGNFSDTSCLK 22 >UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2; Streptococcus pneumoniae|Rep: Putative uncharacterized protein - Streptococcus pneumoniae SP3-BS71 Length = 44 Score = 42.3 bits (95), Expect = 0.012 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = -1 Query: 745 LTGALHLSKNNAGVLRPAQRGQKPRVEQKGKSWLDPDVQ 629 + GA HL +NA VLR A QK VEQKGKS LD D Q Sbjct: 1 MAGAAHLLNDNADVLRGAHGEQKSPVEQKGKSPLDFDFQ 39 >UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; Eukaryota|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 54 Score = 38.3 bits (85), Expect = 0.20 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 441 DCSPIKRERELGLDRRET 388 DCSP RERELGLDRRET Sbjct: 6 DCSPANRERELGLDRRET 23 >UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; Archaea|Rep: RRNA intron-encoded endonuclease - Thermoproteus sp. IC-062 Length = 272 Score = 36.3 bits (80), Expect = 0.81 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -3 Query: 488 DVGSSYHCEAKFAKRWIVHPSKGNVSWV*TVVRQVSFTL 372 DV SS+ A AK + P KGNV WV TV RQV L Sbjct: 228 DVVSSHPGGAAAAKGGVARPLKGNVRWVQTVARQVGLYL 266 >UniRef50_O74086 Cluster: Putative uncharacterized protein PHS003; n=1; Pyrococcus horikoshii|Rep: Putative uncharacterized protein PHS003 - Pyrococcus horikoshii Length = 52 Score = 35.9 bits (79), Expect = 1.1 Identities = 19/34 (55%), Positives = 20/34 (58%) Frame = -1 Query: 751 GSLTGALHLSKNNAGVLRPAQRGQKPRVEQKGKS 650 GSL GA K G LR AQ GQ+ VE KGKS Sbjct: 2 GSLAGAARPRKGIGGALRSAQAGQESAVECKGKS 35 >UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Predicted protein - Sclerotinia sclerotiorum 1980 Length = 147 Score = 34.7 bits (76), Expect = 2.5 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +3 Query: 432 VNNPTLGEFCFAMIGRADIEGSK 500 VN+P L EFCF + RADIEGS+ Sbjct: 120 VNSPMLTEFCFGIRERADIEGSE 142 >UniRef50_Q0U498 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 338 Score = 34.3 bits (75), Expect = 3.3 Identities = 28/104 (26%), Positives = 42/104 (40%) Frame = +2 Query: 23 TELFPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSI 202 T +FP+ S DA I + P +RV T++ L P+ RG V Sbjct: 225 TPIFPERESLDADTLALMRQIHPKPPFQYYQRVETRLSSTKI--DAALRDPEPRGGMVD- 281 Query: 203 SLPDSARLASALEAFRHIPRMVASHHRPLGRVHEPNVRNCGSSR 334 P+SA + L + RP+GR ++P V+ G R Sbjct: 282 --PESAEKVTKLAMPESSEKKPRGRGRPIGRKNKPKVKPRGRGR 323 >UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; Bacteria|Rep: Putative uncharacterized protein - Magnetospirillum gryphiswaldense Length = 76 Score = 33.9 bits (74), Expect = 4.3 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -2 Query: 450 QALDCSPIKRERELGLDRRET 388 Q CSPIK RELGL+RRET Sbjct: 17 QGFGCSPIKVVRELGLERRET 37 >UniRef50_A4DID9 Cluster: Putative uncharacterized protein; n=10; Firmicutes|Rep: Putative uncharacterized protein - Listeria monocytogenes FSL N3-165 Length = 112 Score = 33.5 bits (73), Expect = 5.7 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = -3 Query: 488 DVGSSYHCEAKFAKRWIVHPSKGNVSWV*TVVRQ 387 DVGSS+ K W V P K + SWV VVRQ Sbjct: 68 DVGSSHPGAVVGPKGWAVRPLKRHASWVQNVVRQ 101 >UniRef50_UPI0000E2442A Cluster: PREDICTED: hypothetical protein; n=1; Pan troglodytes|Rep: PREDICTED: hypothetical protein - Pan troglodytes Length = 216 Score = 32.7 bits (71), Expect = 9.9 Identities = 21/71 (29%), Positives = 33/71 (46%) Frame = -2 Query: 288 SGRWCEATIRGICLNASKAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRR 109 S RW ++++G C++ E S +ESG L PR GG + + R++ Sbjct: 10 SPRWAGSSLQGHCVHG---ETSSSESGGRGLEGWPRHRGGGRSRSHVRSATGGVPGPRQQ 66 Query: 108 SPFGSRRSMLS 76 F RRS+ S Sbjct: 67 DGFSHRRSLPS 77 >UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20; n=1; Yarrowia lipolytica|Rep: Serine/threonine-protein kinase STE20 - Yarrowia lipolytica (Candida lipolytica) Length = 1125 Score = 32.7 bits (71), Expect = 9.9 Identities = 22/69 (31%), Positives = 30/69 (43%) Frame = -3 Query: 299 ALGRAAGGAKLPSAGYA*TPLRPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR 120 A G + GA PSA P RP PA P + S+ +P S +T L AF + + Sbjct: 639 ASGDSGAGAAPPSAAPKSPPPRPPPA--PPLGVPSVHAPNSEYRQKMITQLEAFNAKRQQ 696 Query: 119 RDVEAHLDR 93 E H + Sbjct: 697 ERAERHAQK 705 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 766,347,055 Number of Sequences: 1657284 Number of extensions: 15562766 Number of successful extensions: 39665 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 38337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39654 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61734884250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -