BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0404 (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 3.3 At5g18000.1 68418.m02111 transcriptional factor B3 family protei... 28 5.8 At4g39070.1 68417.m05533 zinc finger (B-box type) family protein... 28 7.6 At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 28 7.6 At1g14740.1 68414.m01762 expressed protein 28 7.6 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -2 Query: 693 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 580 LS R W RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At5g18000.1 68418.m02111 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 307 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 464 RNDRKSRHRRIKKQRAMNAWLPQASYPC 547 R +RKS ++ +KK+ + +W ++S+PC Sbjct: 135 REERKSIYKDVKKEEEIESW-SESSHPC 161 >At4g39070.1 68417.m05533 zinc finger (B-box type) family protein salt-tolerance protein - Arabidopsis thaliana, PID:e224078 Length = 242 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 640 DQASFCPFAPREVSVLAELALGHLRYSLTDVT 735 D+A+ C R V +LA HLR+SLT T Sbjct: 20 DEAALCNGCDRHVHFANKLAGKHLRFSLTSPT 51 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -2 Query: 285 GRWCEATIRGICLNASKAEASLAESGKDMLTVEPRESGGSKQCD 154 G W + + +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 >At1g14740.1 68414.m01762 expressed protein Length = 733 Score = 27.9 bits (59), Expect = 7.6 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = -2 Query: 345 YCSVREEPQFRTFGSCTRP-SGRWCEATIRGICLNASKAEASLAESGKDMLTVEPRESGG 169 + +VR F S + P SG E T+ +C N+ K SL + GK+++T S Sbjct: 46 FLNVRSNNLDGGFSSKSSPRSGN--ELTLSYLCENSGKLAESLGQKGKEVVTFSENSSYD 103 Query: 168 SK--QCDFTSRVSHSKRETRRRS 106 K + DF + + ++R++ Sbjct: 104 DKWVERDFFNLREMNPNSSKRKA 126 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,482,053 Number of Sequences: 28952 Number of extensions: 341588 Number of successful extensions: 902 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -