BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0393 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 3.3 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 24 4.4 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 4.4 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 4.4 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 24 5.9 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 7.7 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 154 RIRFPSKPDTPRSSEPILIPKLRIQFADFPYL 59 R+R + TP+ +++PKL+ + A P+L Sbjct: 5 RLRLITSFGTPQDKRTMVLPKLKDETAVMPFL 36 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 24.2 bits (50), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 106 LALRTGACRVWTGSGCGRCRVWSM 177 +++ G V G+ C C VWSM Sbjct: 5 ISVHVGQAGVQIGNPCWDCTVWSM 28 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 4.4 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 170 QTRHRPHPLPVQTRHAPVLRANPYSEVT 87 Q H PH Q +H P + P++ V+ Sbjct: 72 QLHHSPHQYHQQVQHQPQPPSTPFANVS 99 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 4.4 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 170 QTRHRPHPLPVQTRHAPVLRANPYSEVT 87 Q H PH Q +H P + P++ V+ Sbjct: 73 QLHHSPHQYHQQVQHQPQPPSTPFANVS 100 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 239 YIFNMNSRKSSYVSDWIRTRVLRPSADL 322 ++ N K +Y W+R R L P ADL Sbjct: 334 FVLEANGVKDTY---WVRLRSLGPCADL 358 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 394 PLNGGRTESCRSRTKRNR 341 P +GGR SCRS R R Sbjct: 262 PRSGGRWPSCRSPPARRR 279 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 807,369 Number of Sequences: 2352 Number of extensions: 16671 Number of successful extensions: 41 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -