BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0392 (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 42 2e-05 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 41 4e-05 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 41 4e-05 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 41 4e-05 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 24 4.5 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 24 4.5 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 23 7.9 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 41.9 bits (94), Expect = 2e-05 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +3 Query: 510 FGYPFDRPVLPQYFKQPNMFFKKVLVYHEGEL 605 FGYPFDR + YF NM+FK V ++H E+ Sbjct: 655 FGYPFDRVINFNYFYTKNMYFKDVFIFHNDEM 686 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 41.1 bits (92), Expect = 4e-05 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +3 Query: 510 FGYPFDRPVLPQYFKQPNMFFKKVLVYHEGEL 605 FGYPFDR + YF NM+FK V ++H E+ Sbjct: 655 FGYPFDRVINFNYFYTKNMYFKDVFIFHTEEM 686 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 41.1 bits (92), Expect = 4e-05 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +3 Query: 510 FGYPFDRPVLPQYFKQPNMFFKKVLVYHEGEL 605 FGYPFDR + YF NM+FK V ++H E+ Sbjct: 655 FGYPFDRVINFNYFYTKNMYFKDVFIFHTEEM 686 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 41.1 bits (92), Expect = 4e-05 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +3 Query: 510 FGYPFDRPVLPQYFKQPNMFFKKVLVYHEGEL 605 FGYPFDR + YF NM+FK V ++H E+ Sbjct: 655 FGYPFDRVINFNYFYTKNMYFKDVFIFHTEEM 686 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 24.2 bits (50), Expect = 4.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 25 RTSFSYLAGWKNHCS 69 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 24.2 bits (50), Expect = 4.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 25 RTSFSYLAGWKNHCS 69 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.4 bits (48), Expect = 7.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 394 DIVKKYFPLSFRLIMAGNYVKLIYRNYNLALKLGSTTNPSNER 266 ++V+ Y P LI GN V + + + L+ GS SNE+ Sbjct: 112 NLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQ 154 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,780 Number of Sequences: 2352 Number of extensions: 14884 Number of successful extensions: 40 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -