BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0391 (851 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC543.04 |||UPF0171 family protein|Schizosaccharomyces pombe|c... 29 0.84 SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 27 3.4 SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po... 27 3.4 SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr... 26 5.9 >SPBC543.04 |||UPF0171 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 585 Score = 29.1 bits (62), Expect = 0.84 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -1 Query: 785 HRSPRSKWLRRRVSRFECETRLVKSHCLEPPD-SRGSTVSISLPDSA 648 H P +W +RR R E+ SH + P+ S ST S + S+ Sbjct: 112 HIGPNGEWAKRRKPRTTVESNASSSHLVSKPESSHPSTGSFEVKSSS 158 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.1 bits (57), Expect = 3.4 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 137 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMF 238 Y+C + +S G L SED ++ W K GLI+ F Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQF 162 >SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1396 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 420 LANFVRNDRKSRH-RRIKKQRRYERLAAT 337 LANF+R DR+S H +K++ Y ++A++ Sbjct: 696 LANFIRYDRESVHIPEFQKRKSYSQVASS 724 >SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 697 Score = 26.2 bits (55), Expect = 5.9 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 337 CGSQAFIATLLFDPSMSALPIIANKIRQAL 426 CGS I +LF S S L + KI Q L Sbjct: 511 CGSSPAIKLILFSKSFSVLQSTSEKIEQLL 540 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,577,883 Number of Sequences: 5004 Number of extensions: 74537 Number of successful extensions: 171 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 422462090 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -