BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0391 (851 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 74 8e-13 AF091081-1|AAC72950.1| 303|Homo sapiens unknown protein. 31 5.3 BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. 31 7.0 AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type ... 31 7.0 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 73.7 bits (173), Expect = 8e-13 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 401 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSC*K 291 MIGRADIEGSKS+VAMNAW PQASYPCGNFS TSC K Sbjct: 1 MIGRADIEGSKSDVAMNAWPPQASYPCGNFSDTSCLK 37 >AF091081-1|AAC72950.1| 303|Homo sapiens unknown protein. Length = 303 Score = 31.1 bits (67), Expect = 5.3 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 567 CTRPSGRWCELT-IRGIMPERL*GRSQPSRIRQGYAHCGAPRVGRL 701 C+RP+GRW +LT + P+ L +PSR + C R RL Sbjct: 170 CSRPAGRWGDLTMLPSPRPQLLPALRRPSRACCAWPTCSPHRPHRL 215 >BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. Length = 322 Score = 30.7 bits (66), Expect = 7.0 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = +2 Query: 551 SDIWFMHSAERPVVRTNHPRDYA*TPLRPKPA*PNPARICSLWSPESRE 697 S W H T+ P TP P P P PA +CS SPE R+ Sbjct: 45 SHSWNQHLQAFAQPGTHFPTSNC-TPTPPTPVLPGPASLCSPASPELRQ 92 >AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type containing 12 protein. Length = 210 Score = 30.7 bits (66), Expect = 7.0 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = +2 Query: 551 SDIWFMHSAERPVVRTNHPRDYA*TPLRPKPA*PNPARICSLWSPESRE 697 S W H T+ P TP P P P PA +CS SPE R+ Sbjct: 45 SHSWNQHLQAFAQPGTHFPTSNC-TPTPPTPVLPGPASLCSPASPELRQ 92 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,660,997 Number of Sequences: 237096 Number of extensions: 3051747 Number of successful extensions: 6682 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6677 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10816958492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -