BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0391 (851 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024847-1|AAK29961.1| 193|Caenorhabditis elegans Hypothetical ... 29 5.5 Z49966-5|CAA90245.1| 445|Caenorhabditis elegans Hypothetical pr... 28 9.7 >AC024847-1|AAK29961.1| 193|Caenorhabditis elegans Hypothetical protein Y65B4BR.8 protein. Length = 193 Score = 28.7 bits (61), Expect = 5.5 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = +2 Query: 170 GQLSEDRNLAWSKRAKAGLIQMFSTHRDSKARPIDPLV*RVF--SKRCQKSYHRDNWL 337 G LS R L + + G I +TH SK D L +VF KRC++ D WL Sbjct: 122 GALSLARCLVSTLTQRLGEIVSTATHLQSKGEKFDSLETKVFLEGKRCKEDI--DTWL 177 >Z49966-5|CAA90245.1| 445|Caenorhabditis elegans Hypothetical protein F35C11.5 protein. Length = 445 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 628 RRSGIIPRMVSSHHRPLGRVHEPNVRNCGS-SRTEQYYYRNT 506 RR + P + S +P G + P + +CGS T Y Y+ T Sbjct: 164 RRRSVAPFLGSGGSQPTGMLISPELWHCGSEGSTRNYTYQAT 205 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,115,231 Number of Sequences: 27780 Number of extensions: 437587 Number of successful extensions: 1108 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1061 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1108 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2118983636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -