BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0388 (806 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1055 - 27234824-27234838,27236087-27236125,27236322-272373... 31 1.4 07_03_0846 - 21983581-21986055 29 3.3 06_01_0655 + 4742267-4742531,4743313-4744136 29 3.3 >06_03_1055 - 27234824-27234838,27236087-27236125,27236322-27237388, 27237422-27237630,27237650-27238053 Length = 577 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = -1 Query: 212 ASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGS 78 A+ A +GK + E E S+QCD T + +S RE ++R+P+ + Sbjct: 430 AAAAAAGKPISEHEAIEHLWSRQCDLTEILQNSSRE-KKRNPYAA 473 >07_03_0846 - 21983581-21986055 Length = 824 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +1 Query: 70 DLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASA 219 DL+D G +R +C+T S PD S VS+ LPD+A+ A A Sbjct: 326 DLQDFTGGCKRNVPLQCQTN--SSSAQTQPDKFYSMVSVRLPDNAQSAVA 373 >06_01_0655 + 4742267-4742531,4743313-4744136 Length = 362 Score = 29.5 bits (63), Expect = 3.3 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 5/94 (5%) Frame = +1 Query: 70 DLRDPN-GLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASALEAFRHNPA 246 ++RDP G+R + F +++ E RG ++ PD A +AS + + A Sbjct: 129 EIRDPRKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVNFPDGAPVAS-----QRSHA 183 Query: 247 DGSSHHRPLGRVHE-PNVRNCGSS---RTEQYYY 336 + SS + P + E P V + G+ T Y Y Sbjct: 184 EPSSMNMPAFSIEEKPAVMSAGNKTMYNTNAYAY 217 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,227,640 Number of Sequences: 37544 Number of extensions: 522543 Number of successful extensions: 1526 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1526 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2197677108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -