BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0384 (809 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces ... 28 1.4 SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 27 3.2 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 25 9.6 >SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces pombe|chr 3|||Manual Length = 278 Score = 28.3 bits (60), Expect = 1.4 Identities = 13/56 (23%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -3 Query: 657 DRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSAR-LERNTVRPPILSTRTASA 493 D + LP+ + P + K+ ++F P+HH + + ++ +P +T A+A Sbjct: 148 DESVIDIPLPSEEYPFEDPKPREKKNKSFKPKHHKKQDINASSAQPKSTTTTEAAA 203 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.1 bits (57), Expect = 3.2 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 648 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMF 749 Y+C + +S G L SED ++ W K GLI+ F Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQF 162 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.4 bits (53), Expect = 9.6 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -1 Query: 239 GYLKRVIVTPAVYPRLLEFLHVDIQST 159 G+++R+ V YP LLE+L++ + S+ Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSS 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,360,420 Number of Sequences: 5004 Number of extensions: 69313 Number of successful extensions: 166 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 394431430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -