BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0384 (809 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 6.4 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 24 6.4 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 6.4 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 6.4 AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. 23 8.4 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 8.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 8.4 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.8 bits (49), Expect = 6.4 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 250 SSISDAHEWINEIPTVPIYYLAKPQP 327 S +SD E ++ +P++P+ +P P Sbjct: 352 SPVSDRSESVSPVPSLPVRSSPEPSP 377 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.8 bits (49), Expect = 6.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 516 ISAGARCFVPSVQSGDVAET 575 ISAG CFV Q G++A+T Sbjct: 360 ISAGKFCFVDIEQFGNMAKT 379 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -1 Query: 629 PPGSVLEP-DHAGVLNGD 579 PPGS+L+P D A V+ G+ Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 6.4 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 251 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 141 D +F L RV TPA P +EFL + D + HC Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670 >AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. Length = 56 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 4/24 (16%) Frame = +1 Query: 604 SGSRTLP----GGEFDWGGTSVKE 663 +G+RT+P GG F GGT +K+ Sbjct: 21 TGARTVPRVFIGGNFVGGGTDIKK 44 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 8.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 650 VPPQSNSPPGSVLEPD 603 +PP SNS P S PD Sbjct: 868 MPPSSNSSPSSYPSPD 883 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 8.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 58 PLNGGRTESCRSRTKRNR 5 P +GGR SCRS R R Sbjct: 262 PRSGGRWPSCRSPPARRR 279 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 870,269 Number of Sequences: 2352 Number of extensions: 19391 Number of successful extensions: 38 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -