BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0384 (809 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51800.1 68418.m06423 expressed protein 31 1.2 At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot... 29 3.7 At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / halo... 29 3.7 At5g05440.1 68418.m00586 expressed protein low similarity to cyt... 29 4.8 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 29 4.8 At5g02040.2 68418.m00125 prenylated rab acceptor (PRA1) family p... 29 4.8 At5g02040.1 68418.m00124 prenylated rab acceptor (PRA1) family p... 29 4.8 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 29 4.8 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 4.8 At3g62370.1 68416.m07006 expressed protein 28 8.4 >At5g51800.1 68418.m06423 expressed protein Length = 972 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 220 MTLLR*PNASSSISDA-HEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLSLTLVW 390 M +LR P++SS I + H+W N I V + L + + ++ E +LL+ ++W Sbjct: 613 MAILRKPDSSSCIENVQHQWPNVIGYVKGFGLWRGEEADKVREGAADPSSLLAEKILW 670 >At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein similar to SP|P22418 Fructose-1,6-bisphosphatase, chloroplast precursor (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) {Spinacia oleracea}; contains Pfam profile PF00316: fructose-1,6-bisphosphatase Length = 404 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 418 ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 308 A+ + SP+N+ L S SS +D P PL +VS D Sbjct: 105 ASLVASPFNSSLGKLSVNSSSGSDRDAPKPLDIVSND 141 >At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase familiy protein similar to SP|O14072 Cation-transporting ATPase 4 (EC 3.6.3.-) {Schizosaccharomyces pombe}; contains InterPro accession IPR001757: ATPase, E1-E2 type; contains Pfam profile PF00702: haloacid dehalogenase-like hydrolase Length = 1179 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -1 Query: 785 IDRPCFRSPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTD 651 +D CF + +DQA C P + S E+ H R +TD Sbjct: 73 VDFKCFVQFSKVNSIDQADACKVTPAKFSGSKEVVPLHFRSQMTD 117 >At5g05440.1 68418.m00586 expressed protein low similarity to cytokinin-specific binding protein [Vigna radiata] GI:4190976 Length = 203 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -1 Query: 593 VLNGDER---FRHVTTLHAWNETPCXXXXXXXAPLPPNRVSNETMKVV 459 V+ GD R +R VTTLHA ++ +PP ET+ V Sbjct: 138 VVGGDHRLKNYRSVTTLHASDDEGTVVVESYIVDVPPGNTEEETLSFV 185 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -1 Query: 221 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 111 ++T V P ++ F+H I + ++ + V+ + GH+ + Sbjct: 33 VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 69 >At5g02040.2 68418.m00125 prenylated rab acceptor (PRA1) family protein contains Pfam PF03208: PRA1 family protein Length = 209 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 256 LMTRHLATLRES*LLPPFTRACLNFFTLTFRALGRNH 146 L+ HLAT+ + L P +A N F FRA+ RN+ Sbjct: 170 LLIAHLATILHASLRTPNLKARFNTFREEFRAVWRNY 206 >At5g02040.1 68418.m00124 prenylated rab acceptor (PRA1) family protein contains Pfam PF03208: PRA1 family protein Length = 209 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 256 LMTRHLATLRES*LLPPFTRACLNFFTLTFRALGRNH 146 L+ HLAT+ + L P +A N F FRA+ RN+ Sbjct: 170 LLIAHLATILHASLRTPNLKARFNTFREEFRAVWRNY 206 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -1 Query: 221 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 111 ++T V P ++ F+H I + ++ + V+ + GH+ + Sbjct: 32 VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 68 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -1 Query: 650 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 534 +P SNS P +VL + A + GD H TT+H W+ET Sbjct: 5 LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -1 Query: 635 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 540 N+ PG + P G NG +RF H+ ++AWN Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,174,507 Number of Sequences: 28952 Number of extensions: 389588 Number of successful extensions: 1105 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1105 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1843581600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -