BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0382 (483 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34494| Best HMM Match : PI-PLC-X (HMM E-Value=4.9e-05) 27 6.1 SB_22054| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 >SB_34494| Best HMM Match : PI-PLC-X (HMM E-Value=4.9e-05) Length = 332 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -2 Query: 245 NFH*NSNLKYLCDIQFHKIN-TITGFI 168 N H LK LCD ++HK N IT F+ Sbjct: 290 NIHLTGWLKALCDSKYHKFNIIITDFV 316 >SB_22054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 27.5 bits (58), Expect = 6.1 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = -1 Query: 174 IYICILFYACVR*VLHDIKFFF----LVCHLSVNGNFGAFENT 58 I+I +FY C+ VL F+F L+CH+ ++ A++NT Sbjct: 76 IWIICIFYVCIFAVLQGPVFYFHAGKLICHIRLHDM--AYKNT 116 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,674,451 Number of Sequences: 59808 Number of extensions: 261059 Number of successful extensions: 335 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 335 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1013948003 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -