BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0382 (483 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC023660-1|AAH23660.1| 410|Homo sapiens epithelial stromal inte... 29 6.5 AL445217-1|CAM17275.1| 410|Homo sapiens epithelial stromal inte... 29 6.5 AL137878-1|CAM13100.1| 410|Homo sapiens epithelial stromal inte... 29 6.5 >BC023660-1|AAH23660.1| 410|Homo sapiens epithelial stromal interaction 1 (breast) protein. Length = 410 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = -1 Query: 273 HTLLLLVTIEFSLKF*FEISM*HSISQN*YNNWIYICILFYACVR*VLHDIKFFFLVC 100 H +L L I FSL IS H++ + ++W+ + +L YAC+ ++ ++ F L C Sbjct: 347 HEMLFLNVILFSLTVFTLISTAHTLDRAVRSDWL-LLVLIYACLEELIPEL-IFNLYC 402 >AL445217-1|CAM17275.1| 410|Homo sapiens epithelial stromal interaction 1 (breast) protein. Length = 410 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = -1 Query: 273 HTLLLLVTIEFSLKF*FEISM*HSISQN*YNNWIYICILFYACVR*VLHDIKFFFLVC 100 H +L L I FSL IS H++ + ++W+ + +L YAC+ ++ ++ F L C Sbjct: 347 HEMLFLNVILFSLTVFTLISTAHTLDRAVRSDWL-LLVLIYACLEELIPEL-IFNLYC 402 >AL137878-1|CAM13100.1| 410|Homo sapiens epithelial stromal interaction 1 (breast) protein. Length = 410 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = -1 Query: 273 HTLLLLVTIEFSLKF*FEISM*HSISQN*YNNWIYICILFYACVR*VLHDIKFFFLVC 100 H +L L I FSL IS H++ + ++W+ + +L YAC+ ++ ++ F L C Sbjct: 347 HEMLFLNVILFSLTVFTLISTAHTLDRAVRSDWL-LLVLIYACLEELIPEL-IFNLYC 402 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,832,217 Number of Sequences: 237096 Number of extensions: 1250090 Number of successful extensions: 1318 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1318 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4327667848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -