BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0380 (696 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 3.7 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 3.7 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 3.7 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 3.7 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 3.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.8 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 482 TIRDSYEASNRNEYTLNILTRNNWR 556 ++ ++Y+ SN N Y N NN++ Sbjct: 84 SLSNNYKYSNYNNYNNNNYNNNNYK 108 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 482 TIRDSYEASNRNEYTLNILTRNNWR 556 ++ ++Y+ SN N Y N NN++ Sbjct: 84 SLSNNYKYSNYNNYNNNNYNNNNYK 108 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 482 TIRDSYEASNRNEYTLNILTRNNWR 556 ++ ++Y+ SN N Y N NN++ Sbjct: 84 SLSNNYKYSNYNNYNNNNYNNNNYK 108 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 482 TIRDSYEASNRNEYTLNILTRNNWR 556 ++ ++Y+ SN N Y N NN++ Sbjct: 84 SLSNNYKYSNYNNYNNNNYNNNNYK 108 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 3.7 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +3 Query: 39 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 173 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 417 SKEGSRRANYPLPARGGSDEK*RYG 491 +K S+ AN P PA GG + + G Sbjct: 1014 AKPQSQEANKPKPATGGKGTRPKRG 1038 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,018 Number of Sequences: 438 Number of extensions: 4350 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -