BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0379 (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA... 29 3.4 At4g08480.1 68417.m01399 mitogen-activated protein kinase, putat... 28 4.5 At2g44630.1 68415.m05555 kelch repeat-containing F-box family pr... 27 7.9 At1g74690.1 68414.m08650 calmodulin-binding family protein low s... 27 7.9 >At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA helicase DBP2 - Saccharomyces cerevisiae, PID:g5272 Length = 542 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 310 VRSKSGETLMEDRSDSDVQSIVGTGYRGERLIEPSSSWFRP 188 V + G+ +ME SD VG RG EP S+W++P Sbjct: 24 VVEEPGKGMMEHLSDKKKLMSVGELARGITYTEPLSTWWKP 64 >At4g08480.1 68417.m01399 mitogen-activated protein kinase, putative similar to mitogen-activated protein kinase [Arabidopsis thaliana] gi|1255448|dbj|BAA09057; contains Pfam PF00069: Protein kinase domain Length = 773 Score = 28.3 bits (60), Expect = 4.5 Identities = 16/69 (23%), Positives = 28/69 (40%) Frame = +3 Query: 150 KFYIDASYPEGNFGRNQLLDGSISLSPLYPVPTIDCTSESLRSSIRVSPDFDLTRHSSPS 329 K +D+ E G + + P+ +P +D S +PD ++ R S S Sbjct: 375 KEVVDSGTVENRRGIKGVRPSVLKPPPVMKLPPVDLPGSSWDILTHFAPDSEIVRRPSSS 434 Query: 330 FGSQHLCSE 356 S++ C E Sbjct: 435 SSSENGCDE 443 >At2g44630.1 68415.m05555 kelch repeat-containing F-box family protein similar to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF00646: F-box domain, PF01344: Kelch motif Length = 372 Score = 27.5 bits (58), Expect = 7.9 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +3 Query: 216 ISLSPLYPVPTIDCTSESLRSSIRVSPDFDLTRHSSPSFGSQHLC 350 ++L P P + C S+SLRS IR SP+ TR S S +LC Sbjct: 36 LALVPKRYYPILCCVSKSLRSLIR-SPEIHKTR-SLHGKDSLYLC 78 >At1g74690.1 68414.m08650 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 587 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 33 PASSFE*AGVLTHLKFENRLRSFR 104 PAS+FE + V T +FE RSFR Sbjct: 290 PASNFESSSVQTSFEFEKPKRSFR 313 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,650,876 Number of Sequences: 28952 Number of extensions: 278598 Number of successful extensions: 585 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -