BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0377 (720 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366... 33 0.23 09_04_0202 - 15544498-15545037,15546043-15546449,15546874-155469... 32 0.40 06_02_0022 - 10686901-10687506,10687730-10688680 29 4.9 06_01_0605 + 4373697-4373872,4374840-4374876,4375296-4375399,437... 28 6.5 03_02_0295 + 7178921-7179451,7180083-7180448,7181316-7181450,718... 28 6.5 07_03_0583 - 19684388-19684498,19685083-19685216,19685765-196858... 28 8.6 06_01_1126 - 9277885-9277935,9278129-9278209,9278297-9278350,927... 28 8.6 01_03_0206 - 13783169-13783651,13783761-13783903,13783962-137841... 28 8.6 >08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870, 3661975-3662133,3662193-3662243,3662838-3663018, 3663102-3663228,3663322-3663431,3663529-3663667, 3663767-3663876,3664002-3664071,3664247-3664320, 3664458-3664553,3664682-3664777,3665041-3665168, 3665422-3665656,3665743-3665910,3666274-3666381, 3666468-3666617,3666905-3667015,3667118-3667297, 3667427-3667555,3667819-3667914,3668108-3668293, 3668431-3668603,3668720-3668921 Length = 1150 Score = 33.1 bits (72), Expect = 0.23 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 280 RCPWSPGAKLIGVLHAVHLVVSYQFV 203 RC WSP ++GV + H+V +Y FV Sbjct: 430 RCLWSPDGSILGVAFSKHIVQTYAFV 455 >09_04_0202 - 15544498-15545037,15546043-15546449,15546874-15546977, 15547580-15547788,15548092-15549428,15551680-15551941 Length = 952 Score = 32.3 bits (70), Expect = 0.40 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +1 Query: 448 WKLIALWENNKVYFKILNTELTNTWYWESALTGTATIWPSEST 576 WK I W + LN + T Y +S L IWP +ST Sbjct: 403 WKDIGFWNEGNGILRQLNLGKSTTKYADSVLDLNPVIWPGKST 445 >06_02_0022 - 10686901-10687506,10687730-10688680 Length = 518 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +1 Query: 370 LSNDVQGDDGRPAYGDGKDKTSPRVSWKLIALWENNKVYFKILNTELTN 516 LS+DV YG G T+ + W ++ L +N +V K+ ELTN Sbjct: 307 LSHDVMRVLLSDLYGAGASTTAALIEWGMVDLIQNPEVMTKV-REELTN 354 >06_01_0605 + 4373697-4373872,4374840-4374876,4375296-4375399, 4375942-4376137,4376385-4376451,4376895-4376998, 4377090-4377174,4377309-4377369,4377694-4377825, 4377924-4377993,4379261-4379413,4379583-4379694, 4379779-4379920,4380023-4380140,4380862-4380957, 4381061-4381189 Length = 593 Score = 28.3 bits (60), Expect = 6.5 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 179 SEVITNVVNKLIRNN--KMNCMEYAYQLGSRAPRTSSGIVSQLSSDLSSPKTRLSLCTS 349 SE I+++ N+L R+ K+ C + S A I S+L S LS+ TRL CTS Sbjct: 343 SEFISHLANQLARHQFLKIACQLERKNIAS-AYSLLRVIESELQSYLSAVNTRLGHCTS 400 >03_02_0295 + 7178921-7179451,7180083-7180448,7181316-7181450, 7181533-7181606,7181960-7181999,7182178-7182223, 7182398-7182477,7182585-7182760,7182848-7182973, 7183338-7183430,7184135-7184260,7184815-7184884, 7185262-7185344,7186216-7186329,7186884-7186983, 7187557-7187583 Length = 728 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +1 Query: 376 NDVQGDDGRPAYGDGKDKTSPRVSWKLIALWENNKVYFKILNTELTNTWY 525 N V DDG Y D KD ++ K + K Y + N +L WY Sbjct: 322 NVVDQDDGSDIYFD-KDAEDHEINIKAAICFLRGKAYEALDNCDLARQWY 370 >07_03_0583 - 19684388-19684498,19685083-19685216,19685765-19685888, 19685982-19686251,19686961-19687155,19687236-19687328, 19687411-19687539,19687646-19689277 Length = 895 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 184 SHHKCREQTDTKQQDELHGVRLSTWLQGSKDIVRDCFPVEFR 309 +HHK R QQD L G+ TW Q + + DC + R Sbjct: 415 NHHKRRNGEQESQQDSLVGI---TWSQETGTLSFDCEKIASR 453 >06_01_1126 - 9277885-9277935,9278129-9278209,9278297-9278350, 9278433-9278564,9278641-9278715,9279056-9279133, 9279215-9279327,9279421-9279535,9280565-9280754, 9281355-9281464,9281559-9281654,9281756-9281818, 9281911-9281988,9282452-9282564,9282664-9282721, 9282797-9282920,9282999-9283060,9283131-9283195, 9283264-9283324,9284242-9284307,9284472-9284531, 9284830-9284960,9285517-9285592,9285701-9285769, 9286065-9286112,9286552-9286671,9286918-9287034, 9287290-9287405,9288348-9288519,9289057-9289100, 9290359-9290712,9291680-9291806 Length = 1072 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = +2 Query: 131 YDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLGSRAPRTS 280 YD + K+ L E K S+ +TN+ KL ++++ EY Q + + RT+ Sbjct: 1017 YDDDLAKADSLNEVKLSDFLTNIFVKLWESDRL-LFEYLCQALTDSQRTA 1065 >01_03_0206 - 13783169-13783651,13783761-13783903,13783962-13784128, 13784641-13785149,13786031-13786312,13786397-13786792, 13787232-13787504 Length = 750 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +1 Query: 445 SWKLIALWENNKVYFKILNTELTNTWYWESALTGTATIWPSESTASIV 588 SW IA + V + N + N W+W + GTAT + + +V Sbjct: 516 SWSYIA--NASSVGYAPGNFSMQNNWFWFEKVVGTATPEKDQQDSKVV 561 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,307,490 Number of Sequences: 37544 Number of extensions: 321706 Number of successful extensions: 959 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 943 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -