BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0376 (652 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC31E1.02c |pmr1||P-type ATPase, calcium transporting Pmr1 |Sc... 26 5.4 SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces po... 25 9.5 >SPBC31E1.02c |pmr1||P-type ATPase, calcium transporting Pmr1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 899 Score = 25.8 bits (54), Expect = 5.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 500 LERIYRGKGIFNILKNYSVF 559 L + GKGIFN +KN+ F Sbjct: 669 LSAVEEGKGIFNNIKNFITF 688 >SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 25.0 bits (52), Expect = 9.5 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 16 ILEMVSFNSFNLIVFILFYLSTGLTVFYTFRLIIYVIINDFNLI 147 +L S + + +V IL+YL L VF++ + V+I D N + Sbjct: 231 VLHDGSLSIWQSLVMILYYLLYVLFVFFSGSSGVSVVITDENYL 274 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,252,138 Number of Sequences: 5004 Number of extensions: 18345 Number of successful extensions: 52 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -