BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0374 (781 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 22 6.3 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 6.3 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.4 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 21 8.4 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/50 (24%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 512 ETLELISQGGWRIYVVDVY-GFR*PLNTRWAVSSSTHLSNKKIKYIIYMN 658 E +EL +GGW++ D +W S + K++Y +N Sbjct: 301 EIVELQKEGGWKVVWDDTQKNTHMYKGDQWVAFDSPKAISNKVEYAKSLN 350 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 187 SLKLKTWKKYHNKKYFFRYLN 249 SLK K W K +NK F+Y++ Sbjct: 99 SLKTKEWAKLNNK---FQYID 116 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 311 NKPLITKINKPNIVSSLDTYIQVYRY 388 NK T +NK + S + ++ VYRY Sbjct: 262 NKCDYTCVNKSMLNSHMKSHSNVYRY 287 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 311 NKPLITKINKPNIVSSLDTYIQVYRY 388 NK T +NK + S + ++ VYRY Sbjct: 20 NKCDYTCVNKSMLNSHMKSHSNVYRY 45 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,760 Number of Sequences: 336 Number of extensions: 3812 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -