BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0374 (781 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55774-2|AAA98009.3| 380|Caenorhabditis elegans Hypothetical pr... 28 6.5 Z73899-8|CAA98079.2| 669|Caenorhabditis elegans Hypothetical pr... 28 8.6 >U55774-2|AAA98009.3| 380|Caenorhabditis elegans Hypothetical protein F35G8.1 protein. Length = 380 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 437 WCLPARTYKRSYHLYIYICIPVYMYQGMIQYLVYLSL 327 W P Y+R +H Y+C V + QG+ V L+L Sbjct: 79 WATPLAYYQRVWHFGKYMCYMVSIIQGLSLMWVPLTL 115 >Z73899-8|CAA98079.2| 669|Caenorhabditis elegans Hypothetical protein ZK829.10 protein. Length = 669 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -2 Query: 456 AEIGRVVVPTRADLQEVLPPVYIYLYTCIYVSRDDTIFGLFIFVIKGLFYLVL 298 A I + + T AD+ + Y + CI+VS GLF+ G YL + Sbjct: 383 ALIMKTITVTIADIFNIKMKTYFFDCLCIFVSMVIATSGLFLCFESGPLYLTM 435 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,928,079 Number of Sequences: 27780 Number of extensions: 328898 Number of successful extensions: 654 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 639 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1882685842 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -