Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm0374
         (781 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g65290.1 68418.m08212 LMBR1 integral membrane family protein ...    28   8.0  

>At5g65290.1 68418.m08212 LMBR1 integral membrane family protein
           contains Pfam PF04791: LMBR1-like conserved region
          Length = 733

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 3/62 (4%)
 Frame = -2

Query: 510 VSYNGCPTLQFETHYLFTAEIGRV--VVPTRADLQEVLPPVYIYLYTCIYVSR-DDTIFG 340
           +SYN    +Q  +  +F  ++GR+   VP        + P+ + +YT +  S   D IF 
Sbjct: 446 ISYNFINLIQLHSETIFEKKMGRIDDAVPVFGQRFNEIYPLIMVIYTLLVASNFFDRIFN 505

Query: 339 LF 334
            F
Sbjct: 506 YF 507


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,839,186
Number of Sequences: 28952
Number of extensions: 303728
Number of successful extensions: 605
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 586
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 605
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1746037600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)